CCL14 (NM_032963) Human Recombinant Protein

CCL14 protein,

Product Info Summary

SKU: PROTQ16627
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CCL14 (NM_032963) Human Recombinant Protein

View all CCL14 recombinant proteins

SKU/Catalog Number

PROTQ16627

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CCL14 (NM_032963) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16627)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.6 kDa

Amino Acid Sequence

MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Validation Images & Assay Conditions

Gene/Protein Information For CCL14 (Source: Uniprot.org, NCBI)

Gene Name

CCL14

Full Name

C-C motif chemokine 14

Weight

8.6 kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

C-C motif chemokine 14; CCL14; chemokine (C-C motif) ligand 14; Chemokine CC-1/CC-3; chemokine CC-3; CKB1; FLJ16015; HCC-1; HCC-1(1-74); HCC-1/HCC-3; HCC-3; hemofiltrate CC chemokine 1; MCIF; member 14; NCC2CC-1; NCC-2CKb1; new CC chemokine 2; SCYA14CC-3; Small-inducible cytokine A14 CCL14 CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14 C-C motif chemokine ligand 14 C-C motif chemokine 14|chemokine (C-C motif) ligand 14|chemokine CC-1/CC-3|chemokine CC-3|hemofiltrate CC chemokine 1|new CC chemokine 2|small inducible cytokine subfamily A (Cys-Cys), member 14|small-inducible cytokine A14

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL14, check out the CCL14 Infographic

CCL14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16627

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCL14 (NM_032963) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCL14 (NM_032963) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCL14 (NM_032963) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16627
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.