CDC42EP2 (NM_006779) Human Recombinant Protein

CDC42EP2 protein,

Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2)

Product Info Summary

SKU: PROTO14613
Size: 20 µg
Source: HEK293T

Product Name

CDC42EP2 (NM_006779) Human Recombinant Protein

View all CDC42EP2 recombinant proteins

SKU/Catalog Number

PROTO14613

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 2 (CDC42EP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDC42EP2 (NM_006779) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14613)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.3 kDa

Amino Acid Sequence

MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT

Validation Images & Assay Conditions

Gene/Protein Information For CDC42EP2 (Source: Uniprot.org, NCBI)

Gene Name

CDC42EP2

Full Name

Cdc42 effector protein 2

Weight

22.3 kDa

Superfamily

BORG/CEP family

Alternative Names

BORG1CEP2Binder of Rho GTPases 1; CDC42 effector protein (Rho GTPase binding) 2; cdc42 effector protein 2; CRIB-containing BOGR1 protein CDC42EP2 BORG1, CEP2 CDC42 effector protein 2 cdc42 effector protein 2|CDC42 effector protein (Rho GTPase binding) 2|CRIB-containing BOGR1 protein|binder of Rho GTPases 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDC42EP2, check out the CDC42EP2 Infographic

CDC42EP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDC42EP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14613

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDC42EP2 (NM_006779) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDC42EP2 (NM_006779) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDC42EP2 (NM_006779) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14613
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.