CHMP4A (NM_014169) Human Recombinant Protein

CHMP4A protein,

Product Info Summary

SKU: PROTQ9BY43
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CHMP4A (NM_014169) Human Recombinant Protein

View all CHMP4A recombinant proteins

SKU/Catalog Number

PROTQ9BY43

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromatin modifying protein 4A (CHMP4A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

CHMP4A (NM_014169) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BY43)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.098kDa

Amino Acid Sequence

MSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS

Validation Images & Assay Conditions

Gene/Protein Information For CHMP4A (Source: Uniprot.org, NCBI)

Gene Name

CHMP4A

Full Name

Charged multivesicular body protein 4a

Weight

25.098kDa

Superfamily

SNF7 family

Alternative Names

C14orf123; charged multivesicular body protein 4a; CHMP4; CHMP4a; CHMP4B; chromatin modifying protein 4A; Chromatin-modifying protein 4a; chromosome 14 open reading frame 123; FLJ61658; hSnf-1; HSPC134; hVps32-1; MGC142093; MGC142095; SHAX2; SNF7 homolog associated with Alix-2; Snf7 homologue associated with Alix 2; SNF7; SNF7-1; Vacuolar protein sorting-associated protein 32-1; VPS32-1; VPS32A CHMP4A C14orf123, CHMP4, CHMP4B, HSPC134, SHAX2, SNF7, SNF7-1, VPS32-1, VPS32A charged multivesicular body protein 4A charged multivesicular body protein 4a|SNF7 homolog associated with Alix-2|Snf7 homologue associated with Alix 2|chromatin modifying protein 4A|vacuolar protein sorting-associated protein 32-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHMP4A, check out the CHMP4A Infographic

CHMP4A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHMP4A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BY43

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CHMP4A (NM_014169) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review CHMP4A (NM_014169) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHMP4A (NM_014169) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BY43
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.