DCUN1D2 (NM_001014283) Human Recombinant Protein

DCUN1D2 protein,

Product Info Summary

SKU: PROTQ6PH85
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DCUN1D2 (NM_001014283) Human Recombinant Protein

View all DCUN1D2 recombinant proteins

SKU/Catalog Number

PROTQ6PH85

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DCUN1D2 (NM_001014283) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6PH85)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30 kDa

Amino Acid Sequence

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF

Validation Images & Assay Conditions

Gene/Protein Information For DCUN1D2 (Source: Uniprot.org, NCBI)

Gene Name

DCUN1D2

Full Name

DCN1-like protein 2

Weight

30 kDa

Alternative Names

C13orf17; chromosome 13 open reading frame 17; DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae); DCN1-like protein 2; DCUN1 domain-containing protein 2; DCUN1L2; Defective in cullin neddylation protein 1-like protein 2; FLJ10704; FLJ20092 DCUN1D2 C13orf17, DCNL2 defective in cullin neddylation 1 domain containing 2 DCN1-like protein 2|DCN1, defective in cullin neddylation 1, domain containing 2|DCUN1 domain-containing protein 2|defective in cullin neddylation protein 1-like protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DCUN1D2, check out the DCUN1D2 Infographic

DCUN1D2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DCUN1D2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6PH85

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DCUN1D2 (NM_001014283) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DCUN1D2 (NM_001014283) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DCUN1D2 (NM_001014283) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6PH85
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.