HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein

HBXIP protein,

Product Info Summary

SKU: PROTO43504
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein

View all HBXIP recombinant proteins

SKU/Catalog Number

PROTO43504

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hepatitis B virus x interacting protein (HBXIP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43504)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18 kDa

Amino Acid Sequence

MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Validation Images & Assay Conditions

Gene/Protein Information For LAMTOR5 (Source: Uniprot.org, NCBI)

Gene Name

LAMTOR5

Full Name

Ragulator complex protein LAMTOR5

Weight

18 kDa

Superfamily

LAMTOR5 family

Alternative Names

HBV X-interacting protein; HBX-interacting protein; hepatitis B virus x interacting protein; hepatitis B virus x-interacting protein (9.6kD); MGC71071; XIPhepatitis B virus X-interacting protein LAMTOR5 HBXIP, XIP late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 ragulator complex protein LAMTOR5|HBV X-interacting protein|HBx-interacting protein|hepatitis B virus x interacting protein|hepatitis B virus x-interacting protein (9.6kD)|late endosomal/lysosomal adaptor and MAPK and MTOR activator 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LAMTOR5, check out the LAMTOR5 Infographic

LAMTOR5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LAMTOR5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43504

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43504
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.