Product Info Summary
| SKU: | PROTP05019-3 |
|---|---|
| Size: | 100ug,500ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant IGF-I (Insulin-like growth factor-I) protein, AF
View all IGF1 recombinant proteins
SKU/Catalog Number
PROTP05019-3
Size
100ug,500ug
Tag
His Tag (C-term)
Description
Insulin like Growth Factors 1 (IGF-I) is a 7.79 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, Endometrial stromal cells, Leydig cells, and can be isolated from plasma. IGF-I mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IGF-I (Insulin-like growth factor-I) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05019-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
21.8 kDa
Molecular weight
The protein has a calculated MW of 8.59 kDa. The protein migrates as 8-10 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is 0.9-3.1 ng/mL. The specific activity of recombinant human IGF-I is approximately >1.2 x 10³ IU/mg.
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IGF-I
Specific Publications For Human recombinant IGF-I (Insulin-like growth factor-I) protein, AF (PROTP05019-3)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IGF-I (Insulin-like growth factor-I) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IGF-I (Insulin-like growth factor-I) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
