KPNA3 (NM_002267) Human Recombinant Protein

KPNA3 protein,

Recombinant protein of human karyopherin alpha 3 (importin alpha 4) (KPNA3)

Product Info Summary

SKU: PROTO00505
Size: 20 µg
Source: HEK293T

Product Name

KPNA3 (NM_002267) Human Recombinant Protein

View all KPNA3 recombinant proteins

SKU/Catalog Number

PROTO00505

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human karyopherin alpha 3 (importin alpha 4) (KPNA3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

KPNA3 (NM_002267) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00505)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

57.811kDa

Amino Acid Sequence

MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQDIVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFQNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQDVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF

Validation Images & Assay Conditions

Gene/Protein Information For KPNA3 (Source: Uniprot.org, NCBI)

Gene Name

KPNA3

Full Name

Importin subunit alpha-4

Weight

57.811kDa

Superfamily

importin alpha family

Alternative Names

hSRP1; importin alpha 4; Importin alpha Q2; importin alpha-3; importin subunit alpha-3; importin-alpha-Q2; IPOA4; karyopherin alpha 3 (importin alpha 4); Karyopherin subunit alpha-3; qip2; SRP1; SRP1gamma; SRP1-gamma; SRP4 KPNA3 IPOA4, SRP1, SRP1gamma, SRP4, hSRP1 karyopherin subunit alpha 3 importin subunit alpha-4|SRP1-gamma|importin alpha 4|importin alpha Q2|importin alpha-3|importin subunit alpha-3|karyopherin alpha 3 (importin alpha 4)|qip2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KPNA3, check out the KPNA3 Infographic

KPNA3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KPNA3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00505

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KPNA3 (NM_002267) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KPNA3 (NM_002267) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KPNA3 (NM_002267) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00505
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.