Membrin (GOSR2) (NM_004287) Human Recombinant Protein

Membrin protein,

Product Info Summary

SKU: PROTO14653
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Membrin (GOSR2) (NM_004287) Human Recombinant Protein

View all Membrin recombinant proteins

SKU/Catalog Number

PROTO14653

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Membrin (GOSR2) (NM_004287) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14653)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.6 kDa

Amino Acid Sequence

MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT

Validation Images & Assay Conditions

Gene/Protein Information For GOSR2 (Source: Uniprot.org, NCBI)

Gene Name

GOSR2

Full Name

Golgi SNAP receptor complex member 2

Weight

24.6 kDa

Superfamily

GOSR2 family

Alternative Names

golgi SNAP receptor complex member 2; GS27Bos1,27 kDa Golgi SNARE protein; membrin GOSR2 Bos1, EPM6, GS27 golgi SNAP receptor complex member 2 Golgi SNAP receptor complex member 2|27 kDa Golgi SNARE protein|membrin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GOSR2, check out the GOSR2 Infographic

GOSR2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GOSR2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14653

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Membrin (GOSR2) (NM_004287) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Membrin (GOSR2) (NM_004287) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Membrin (GOSR2) (NM_004287) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14653
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.