PHAP1 (ANP32A) (NM_006305) Human Recombinant Protein

ANP32A protein,

Product Info Summary

SKU: PROTP39687
Size: 20 µg
Source: HEK293T

Product Name

PHAP1 (ANP32A) (NM_006305) Human Recombinant Protein

View all ANP32A recombinant proteins

SKU/Catalog Number

PROTP39687

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PHAP1 (ANP32A) (NM_006305) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP39687)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.4 kDa

Amino Acid Sequence

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD

Validation Images & Assay Conditions

Gene/Protein Information For ANP32A (Source: Uniprot.org, NCBI)

Gene Name

ANP32A

Full Name

Acidic leucine-rich nuclear phosphoprotein 32 family member A

Weight

28.4 kDa

Superfamily

ANP32 family

Alternative Names

acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; acidic leucine-rich nuclear phosphoprotein 32 family member A; Acidic nuclear phosphoprotein pp32; cerebellar leucine rich acidic nuclear protein; I1PP2A; inhibitor-1 of protein phosphatase-2A; LANPPutative HLA-DR-associated protein I; Leucine-rich acidic nuclear protein; MAPMC15orf1; mapmodulin; PHAP1MGC150373; PHAPIMGC119787; Potent heat-stable protein phosphatase 2A inhibitor I1PP2A; PP32; putative human HLA class II associated protein I ANP32A C15orf1, HPPCn, I1PP2A, LANP, MAPM, PHAP1, PHAPI, PP32 acidic nuclear phosphoprotein 32 family member A acidic leucine-rich nuclear phosphoprotein 32 family member A|acidic (leucine-rich) nuclear phosphoprotein 32 family, member A|acidic nuclear phosphoprotein pp32|cerebellar leucine rich acidic nuclear protein|epididymis secretory sperm binding protein|hepatopoietin Cn|inhibitor-1 of protein phosphatase-2A|leucine-rich acidic nuclear protein|mapmodulin|potent heat-stable protein phosphatase 2A inhibitor I1PP2A|putative HLA-DR-associated protein I|putative human HLA class II associated protein I

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ANP32A, check out the ANP32A Infographic

ANP32A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ANP32A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP39687

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PHAP1 (ANP32A) (NM_006305) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PHAP1 (ANP32A) (NM_006305) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PHAP1 (ANP32A) (NM_006305) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP39687
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.