PITPN (PITPNA) (NM_006224) Human Recombinant Protein

PITPN protein,

Product Info Summary

SKU: PROTQ00169
Size: 20 µg
Source: HEK293T

Product Name

PITPN (PITPNA) (NM_006224) Human Recombinant Protein

View all PITPN recombinant proteins

SKU/Catalog Number

PROTQ00169

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

PITPN (PITPNA) (NM_006224) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00169)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.806kDa

Amino Acid Sequence

MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

Validation Images & Assay Conditions

Gene/Protein Information For PITPNA (Source: Uniprot.org, NCBI)

Gene Name

PITPNA

Full Name

Phosphatidylinositol transfer protein alpha isoform

Weight

31.806kDa

Superfamily

PtdIns transfer protein family

Alternative Names

MGC99649; phosphatidylinositol transfer protein alpha isoform; phosphatidylinositol transfer protein, alpha; PI-TPalpha; PI-TP-alpha; PITPNphosphotidylinositol transfer protein; PtdIns transfer protein alpha; PtdInsTP alpha; VIB1A PITPNA HEL-S-36, PI-TPalpha, PITPN, VIB1A phosphatidylinositol transfer protein alpha phosphatidylinositol transfer protein alpha isoform|PI-TP-alpha|epididymis secretory protein Li 36|ptdIns transfer protein alpha|ptdInsTP alpha

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PITPNA, check out the PITPNA Infographic

PITPNA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PITPNA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ00169

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PITPN (PITPNA) (NM_006224) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PITPN (PITPNA) (NM_006224) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PITPN (PITPNA) (NM_006224) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00169
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.