PSMB9 (NM_002800) Human Recombinant Protein

LMP2/PSMB9 protein,

Product Info Summary

SKU: PROTP28065
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PSMB9 (NM_002800) Human Recombinant Protein

View all LMP2/PSMB9 recombinant proteins

SKU/Catalog Number

PROTP28065

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) (PSMB9), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PSMB9 (NM_002800) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP28065)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.1 kDa

Amino Acid Sequence

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Validation Images & Assay Conditions

Gene/Protein Information For PSMB9 (Source: Uniprot.org, NCBI)

Gene Name

PSMB9

Full Name

Proteasome subunit beta type-9

Weight

23.1 kDa

Superfamily

peptidase T1B family

Alternative Names

beta1i; LMP2; LMP2MGC70470; Low molecular mass protein 2; Macropain chain 7; Multicatalytic endopeptidase complex chain 7; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2); proteasome catalytic subunit 1i; Proteasome chain 7; proteasome subunit beta 6i; proteasome subunit beta type-9; Proteasome subunit beta-1i; proteasome-related gene 2; PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2); PSMB9; Really interesting new gene 12 protein; RING12; RING12EC 3.4.25.1 PSMB9 LMP2, PRAAS3, PSMB6i, RING12, beta1i proteasome 20S subunit beta 9 proteasome subunit beta type-9|large multifunctional peptidase 2|low molecular mass protein 2|macropain chain 7|multicatalytic endopeptidase complex chain 7|proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)|proteasome catalytic subunit 1i|proteasome chain 7|proteasome subunit beta 6i|proteasome subunit beta 9|proteasome subunit beta-1i|proteasome subunit beta1i|proteasome-related gene 2|really interesting new gene 12 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PSMB9, check out the PSMB9 Infographic

PSMB9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PSMB9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP28065

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PSMB9 (NM_002800) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PSMB9 (NM_002800) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PSMB9 (NM_002800) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP28065
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.