RNS10 (RNASE10) (NM_001012975) Human Recombinant Protein

Rnase10 protein,

Recombinant protein of human ribonuclease, RNase A family, 10 (non-active) (RNASE10)

Product Info Summary

SKU: PROTQ5GAN6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RNS10 (RNASE10) (NM_001012975) Human Recombinant Protein

View all Rnase10 recombinant proteins

SKU/Catalog Number

PROTQ5GAN6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ribonuclease, RNase A family, 10 (non-active) (RNASE10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

RNS10 (RNASE10) (NM_001012975) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5GAN6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.407kDa

Amino Acid Sequence

MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGDGTQTTETLVLSNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECNDMMAHKMKEPSQSCIAQYAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ

Validation Images & Assay Conditions

Gene/Protein Information For Rnase10 (Source: Uniprot.org, NCBI)

Gene Name

Rnase10

Full Name

Inactive ribonuclease-like protein 10

Weight

23.407kDa

Superfamily

pancreatic ribonuclease family

Alternative Names

ribonuclease 10; ribonuclease, RNase A family, 10 (non-active); ribonuclease-like protein 10; RNASE9 Rnase10|4930474F22Rik, Rah1|ribonuclease, RNase A family, 10 (non-active)|inactive ribonuclease-like protein 10|RNase 10|protein train A|ribonuclease A family, member 10|ribonuclease A h1|ribonuclease-like protein 10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Rnase10, check out the Rnase10 Infographic

Rnase10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Rnase10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5GAN6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RNS10 (RNASE10) (NM_001012975) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RNS10 (RNASE10) (NM_001012975) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RNS10 (RNASE10) (NM_001012975) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5GAN6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.