SPARC (NM_003118) Human Recombinant Protein

SPARC protein,

Product Info Summary

SKU: PROTP09486
Size: 20 µg
Source: HEK293T

Product Name

SPARC (NM_003118) Human Recombinant Protein

View all SPARC recombinant proteins

SKU/Catalog Number

PROTP09486

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPARC (NM_003118) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09486)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.5 kDa

Amino Acid Sequence

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Validation Images & Assay Conditions

Gene/Protein Information For SPARC (Source: Uniprot.org, NCBI)

Gene Name

SPARC

Full Name

SPARC

Weight

34.5 kDa

Superfamily

SPARC family

Alternative Names

Basement-membrane protein 40; BM-40; ONcysteine-rich protein; Osteonectin; Secreted protein acidic and rich in cysteine; secreted protein, acidic, cysteine-rich (osteonectin); SPARC SPARC BM-40, OI17, ON, ONT secreted protein acidic and cysteine rich SPARC|basement-membrane protein 40|secreted protein, acidic, cysteine-rich (osteonectin)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPARC, check out the SPARC Infographic

SPARC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPARC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09486

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPARC (NM_003118) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPARC (NM_003118) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPARC (NM_003118) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09486
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.