UBE2N (NM_003348) Human Recombinant Protein

UBE2N/Ubc13 protein,

Product Info Summary

SKU: PROTP61088
Size: 20 µg
Source: HEK293T

Product Name

UBE2N (NM_003348) Human Recombinant Protein

View all UBE2N/Ubc13 recombinant proteins

SKU/Catalog Number

PROTP61088

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

UBE2N (NM_003348) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61088)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.138kDa

Amino Acid Sequence

MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

Validation Images & Assay Conditions

Gene/Protein Information For UBE2N (Source: Uniprot.org, NCBI)

Gene Name

UBE2N

Full Name

Ubiquitin-conjugating enzyme E2 N

Weight

17.138kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

bendless-like ubiquitin conjugating enzyme; Bendless-like ubiquitin-conjugating enzyme; BLU; EC 6.3.2.19; MGC131857; MGC8489; UBC13; UbcH13; UbcH-ben; UBE2N; Ubiquitin carrier protein N; ubiquitin-conjugating enzyme E2 N; ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13); ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast); Ubiquitin-protein ligase N; yeast UBC13 homolog UBE2N HEL-S-71, UBC13, UBCHBEN; UBC13, UbcH-ben, UbcH13 ubiquitin conjugating enzyme E2 N ubiquitin-conjugating enzyme E2 N|E2 ubiquitin-conjugating enzyme N|bendless-like ubiquitin conjugating enzyme|epididymis secretory protein Li 71|ubiquitin carrier protein N|ubiquitin conjugating enzyme E2N|ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)|ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)|ubiquitin-protein ligase N|yeast UBC13 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2N, check out the UBE2N Infographic

UBE2N infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2N: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61088

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBE2N (NM_003348) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2N (NM_003348) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2N (NM_003348) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61088
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.