VPS4A (NM_013245) Human Recombinant Protein

VPS4A protein,

Recombinant protein of human vacuolar protein sorting 4 homolog A (S. cerevisiae) (VPS4A)

Product Info Summary

SKU: PROTQ9UN37
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

VPS4A (NM_013245) Human Recombinant Protein

View all VPS4A recombinant proteins

SKU/Catalog Number

PROTQ9UN37

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human vacuolar protein sorting 4 homolog A (S. cerevisiae) (VPS4A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VPS4A (NM_013245) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UN37)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.7 kDa

Amino Acid Sequence

MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES

Validation Images & Assay Conditions

Gene/Protein Information For VPS4A (Source: Uniprot.org, NCBI)

Gene Name

VPS4A

Full Name

Vacuolar protein sorting-associated protein 4A

Weight

48.7 kDa

Superfamily

AAA ATPase family

Alternative Names

FLJ22197; hVPS4; Protein SKD2; SKD1; SKD1A; SKD2; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog); vacuolar protein sorting factor 4A; vacuolar protein sorting-associated protein 4A; vacuolar sorting protein 4; VPS4-1SKD1-homolog; VPS4vacuolar protein sorting 4A (yeast) VPS4A SKD1, SKD1A, SKD2, VPS4, VPS4-1 vacuolar protein sorting 4 homolog A vacuolar protein sorting-associated protein 4A|SKD1-homolog|hVPS4|vacuolar protein sorting factor 4A|vacuolar sorting protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VPS4A, check out the VPS4A Infographic

VPS4A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VPS4A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UN37

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VPS4A (NM_013245) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VPS4A (NM_013245) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VPS4A (NM_013245) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UN37
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.