AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein

AMPK beta 1 protein,

Product Info Summary

SKU: PROTQ9Y478
Size: 20 µg
Source: HEK293T

Product Name

AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein

View all AMPK beta 1 recombinant proteins

SKU/Catalog Number

PROTQ9Y478

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y478)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.2 kDa

Amino Acid Sequence

MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Validation Images & Assay Conditions

Gene/Protein Information For PRKAB1 (Source: Uniprot.org, NCBI)

Gene Name

PRKAB1

Full Name

5'-AMP-activated protein kinase subunit beta-1

Weight

30.2 kDa

Superfamily

5'-AMP-activated protein kinase beta subunit family

Alternative Names

5'-AMP-activated protein kinase beta-1 subunit; AMP-activated protein kinase beta subunit; AMPK beta -1 chain; AMPK beta 1; AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1; AMPK subunit beta-1; AMPK; AMPKb; HAMPKb; MGC17785; PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; protein kinase, AMP-activated, noncatalytic, beta-1 PRKAB1 AMPK, HAMPKb protein kinase AMP-activated non-catalytic subunit beta 1 5-AMP-activated protein kinase subunit beta-1|5-AMP-activated protein kinase beta-1 subunit|AMP-activated protein kinase beta subunit|AMPK beta -1 chain|AMPK beta 1|AMPK subunit beta-1|AMPKb|protein kinase, AMP-activated, beta 1 non-catalytic subunit|protein kinase, AMP-activated, noncatalytic, beta-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRKAB1, check out the PRKAB1 Infographic

PRKAB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRKAB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y478

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y478
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.