Anti-Aquaporin 2/AQP2 Antibody Picoband®

AQP2 antibody

Boster Bio Anti-Aquaporin 2/AQP2 Antibody Picoband® catalog # PB9474. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 6 publication(s).

Product Info Summary

SKU: PB9474
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Aquaporin 2/AQP2 Antibody Picoband®

View all AQP2 Antibodies

SKU/Catalog Number

PB9474

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Aquaporin 2/AQP2 Antibody Picoband® catalog # PB9474. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Aquaporin 2/AQP2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9474)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2, different from the related mouse and rat sequences by one amino acid.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9474 is reactive to AQP2 in Human, Mouse, Rat

Observed Molecular Weight

26 kDa

Calculated molecular weight

28.8 kDa

Background of AQP2

AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. The AQP2 gene is mapped to chromosome 12q13, very close to the site of major intrinsic protein by situ hybridization. The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus. The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel. Using rat kidney slices and porcine kidney cells stably expressing rat Aqp2, AQP2 trafficking can be stimulated by cAMP-independent pathways that utilize nitric oxide (NO). The NO donors sodium nitroprusside (SNP) and NONOate and the NO synthase substrate L-arginine mimicked the effect of vasopressin (VP), stimulating relocation of Aqp2 from cytoplasmic vesicles to the apical plasma membrane. SNP increased intracellular cGMP rather than cAMP, and exogenous cGMP stimulated AQP2 membrane insertion. Atrial natriuretic factor, which signals via cGMP, also stimulated AQP2 translocation. AQP2 expression in kidney connecting tubules is sufficient for survival and that AQP2 expression in collecting ducts is required to regulate body water balance. The S256L substitution in the cytoplasmic tail of the Aqp2 protein prevented phosphorylation at S256 and the subsequent accumulation of Aqp2 on the apical membrane of the collecting duct principal cells.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9474 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: rat kidney tissue, rat NRK whole cell, rat PC-12 whole cell, mouse kidney tissue, mouse HBZY whole cell, mouse RAW2647 whole cell
IHC: Mouse Kidney tissue, Rat Kidney tissue, Human Renal Cancer tissue
FCM: PC-3 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Aquaporin 2/AQP2 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-Aquaporin 2/AQP2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Aquaporin 2/AQP2 Antibody Picoband®

Question

Is a blocking peptide available for product anti-Aquaporin 2/AQP2 antibody (PB9474)?

G. Johnson

Verified customer

Asked: 2020-05-04

Answer

We do provide the blocking peptide for product anti-Aquaporin 2/AQP2 antibody (PB9474). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2020-05-04

Question

We are currently using anti-Aquaporin 2/AQP2 antibody PB9474 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-04-23

Answer

The anti-Aquaporin 2/AQP2 antibody (PB9474) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-04-23

Question

I was wanting to use your anti-Aquaporin 2/AQP2 antibody for WB for human cortex of kidney on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cortex of kidney identification?

Verified Customer

Verified customer

Asked: 2020-04-21

Answer

As indicated on the product datasheet, PB9474 anti-Aquaporin 2/AQP2 antibody has been validated for Flow Cytometry, IHC, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cortex of kidney in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-21

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cortex of kidney using anti-Aquaporin 2/AQP2 antibody PB9474. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-19

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-19

Question

I have attached the WB image, lot number and protocol we used for cortex of kidney using anti-Aquaporin 2/AQP2 antibody PB9474. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-20

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-20

Question

We have been able to see staining in mouse colon. Are there any suggestions? Is anti-Aquaporin 2/AQP2 antibody supposed to stain colon positively?

L. Jha

Verified customer

Asked: 2019-06-19

Answer

From literature colon does express AQP2. From Uniprot.org, AQP2 is expressed in cortex of kidney, kidney, colon, among other tissues. Regarding which tissues have AQP2 expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 15489334
Kidney, Pubmed ID: 7510718, 11929850

Boster Scientific Support

Answered: 2019-06-19

Question

Would PB9474 anti-Aquaporin 2/AQP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-05-31

Answer

As indicated on the product datasheet, PB9474 anti-Aquaporin 2/AQP2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-05-31

Question

Will anti-Aquaporin 2/AQP2 antibody PB9474 work for WB with cortex of kidney?

K. Edwards

Verified customer

Asked: 2019-02-27

Answer

According to the expression profile of cortex of kidney, AQP2 is highly expressed in cortex of kidney. So, it is likely that anti-Aquaporin 2/AQP2 antibody PB9474 will work for WB with cortex of kidney.

Boster Scientific Support

Answered: 2019-02-27

Question

Is there a BSA free version of anti-Aquaporin 2/AQP2 antibody PB9474 available?

Verified Customer

Verified customer

Asked: 2018-10-26

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Aquaporin 2/AQP2 antibody PB9474 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-10-26

Question

Our lab were well pleased with the WB result of your anti-Aquaporin 2/AQP2 antibody. However we have seen positive staining in cortex of kidney apical cell membrane using this antibody. Is that expected? Could you tell me where is AQP2 supposed to be expressed?

R. Wu

Verified customer

Asked: 2018-09-27

Answer

From literature, cortex of kidney does express AQP2. Generally AQP2 expresses in apical cell membrane. Regarding which tissues have AQP2 expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 15489334
Kidney, Pubmed ID: 7510718, 11929850

Boster Scientific Support

Answered: 2018-09-27

Question

We bought anti-Aquaporin 2/AQP2 antibody for WB on colon in a previous project. I am using human, and We are going to use the antibody for Flow Cytometry next. you antibody examining colon as well as cortex of kidney in our next experiment. Could you please give me some suggestion on which antibody would work the best for Flow Cytometry?

Verified Customer

Verified customer

Asked: 2018-07-09

Answer

I looked at the website and datasheets of our anti-Aquaporin 2/AQP2 antibody and I see that PB9474 has been tested on human in both WB and Flow Cytometry. Thus PB9474 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-07-09

Question

Can you help my question with product PB9474, anti-Aquaporin 2/AQP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-06-21

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9474 anti-Aquaporin 2/AQP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-06-21

Question

We want using your anti-Aquaporin 2/AQP2 antibody for protein homotetramerization studies. Has this antibody been tested with western blotting on mouse kidney tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-03-16

Answer

We appreciate your inquiry. This PB9474 anti-Aquaporin 2/AQP2 antibody is tested on rat kidney tissue, tissue lysate, mouse kidney tissue, hela whole cell lysate, a549 whole cell lysate, panc whole cell lysate, renal cancer tissue. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-03-16

Question

I am interested in to test anti-Aquaporin 2/AQP2 antibody PB9474 on human cortex of kidney for research purposes, then I may be interested in using anti-Aquaporin 2/AQP2 antibody PB9474 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

L. Krishna

Verified customer

Asked: 2016-11-08

Answer

The products we sell, including anti-Aquaporin 2/AQP2 antibody PB9474, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2016-11-08

Question

I see that the anti-Aquaporin 2/AQP2 antibody PB9474 works with WB, what is the protocol used to produce the result images on the product page?

Z. Johnson

Verified customer

Asked: 2016-01-22

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2016-01-22

Question

Is this PB9474 anti-Aquaporin 2/AQP2 antibody reactive to the isotypes of AQP2?

F. Edwards

Verified customer

Asked: 2015-08-07

Answer

The immunogen of PB9474 anti-Aquaporin 2/AQP2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-08-07

Order DetailsPrice
PB9474

100μg

$370
PB9474-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9474-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9474-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9474-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9474-APC

100 μg APC conjugated (liquid)

$820
PB9474-FITC

100 μg FITC conjugated (liquid)

$570
PB9474-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9474-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9474-HRP

100 μg HRP conjugated (liquid)

$570
PB9474-PE

100 μg PE conjugated (liquid)

$820
PB9474-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9474
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 2, 2026