Anti-NIRF/UHRF2 Antibody Picoband®

UHRF2 antibody

Boster Bio Anti-NIRF/UHRF2 Antibody Picoband® catalog # PB9906. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: PB9906
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-NIRF/UHRF2 Antibody Picoband®

View all UHRF2 Antibodies

SKU/Catalog Number

PB9906

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-NIRF/UHRF2 Antibody Picoband® catalog # PB9906. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-NIRF/UHRF2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9906)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9906 is reactive to UHRF2 in Human, Mouse, Rat

Observed Molecular Weight

90 kDa

Calculated molecular weight

90.0 kDa

Background of UHRF2

E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9906 is guaranteed for IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat
Western blot0.1-0.5μg/mlHuman, Rat

Tested application

NIRF antibody was positively detected by WB in:
rat testis tissue, K562 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
NIRF antibody was positively detected by IHC in:
mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-NIRF/UHRF2 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-NIRF/UHRF2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-NIRF/UHRF2 Antibody Picoband®

Question

Is this PB9906 anti-NIRF/UHRF2 antibody reactive to the isotypes of UHRF2?

Verified Customer

Verified customer

Asked: 2019-09-18

Answer

The immunogen of PB9906 anti-NIRF/UHRF2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-18

Question

We are currently using anti-NIRF/UHRF2 antibody PB9906 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

J. Evans

Verified customer

Asked: 2019-04-26

Answer

The anti-NIRF/UHRF2 antibody (PB9906) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-04-26

Question

Is there a BSA free version of anti-NIRF/UHRF2 antibody PB9906 available?

Verified Customer

Verified customer

Asked: 2019-04-02

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-NIRF/UHRF2 antibody PB9906 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-04-02

Question

Is a blocking peptide available for product anti-NIRF/UHRF2 antibody (PB9906)?

A. Li

Verified customer

Asked: 2017-08-14

Answer

We do provide the blocking peptide for product anti-NIRF/UHRF2 antibody (PB9906). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2017-08-14

Question

Can you help my question with product PB9906, anti-NIRF/UHRF2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

N. Bhatt

Verified customer

Asked: 2017-04-26

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9906 anti-NIRF/UHRF2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-04-26

Question

Does PB9906 anti-NIRF/UHRF2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

K. Lewis

Verified customer

Asked: 2016-01-19

Answer

As indicated on the product datasheet, PB9906 anti-NIRF/UHRF2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-01-19

Question

I was wanting to use your anti-NIRF/UHRF2 antibody for WB for human cervix carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma identification?

A. Edwards

Verified customer

Asked: 2015-02-19

Answer

You can see on the product datasheet, PB9906 anti-NIRF/UHRF2 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-02-19

Order DetailsPrice
PB9906

100μg

$370
PB9906-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9906-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9906-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9906-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9906-APC

100 μg APC conjugated (liquid)

$820
PB9906-FITC

100 μg FITC conjugated (liquid)

$570
PB9906-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9906-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9906-HRP

100 μg HRP conjugated (liquid)

$570
PB9906-PE

100 μg PE conjugated (liquid)

$820
PB9906-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9906
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 25, 2026