Anti-PGP9.5/UCHL1 Antibody Picoband®

UCHL1 antibody

Boster Bio Anti-PGP9.5/UCHL1 Antibody Picoband® catalog # PB9840. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 4 publication(s).

Product Info Summary

SKU: PB9840
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-PGP9.5/UCHL1 Antibody Picoband®

View all UCHL1 Antibodies

SKU/Catalog Number

PB9840
PB0854 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PGP9.5/UCHL1 Antibody Picoband® catalog # PB9840. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PGP9.5/UCHL1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9840)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5, different from the related mouse and rat sequences by two amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9840 is reactive to UCHL1 in Human, Mouse, Rat

Observed Molecular Weight

25 kDa

Calculated molecular weight

24.8 kDa

Background of UCHL1

UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9840 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat
Immunocytochemistry/Immunofluorescence2μg/mlHuman
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

PGP9.5 antibody was positively detected by WB in:
human U87 whole cell, human SH-SY5Y whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
PGP9.5 antibody was positively detected by IHC in:
mouse brain tissue, rat brain tissue, human glioma tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
PGP9.5 antibody was positively detected by ICC/IF in:
SH-SY5Y cell
PGP9.5 antibody was positively detected by FC in:
K562 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-PGP9.5/UCHL1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-PGP9.5/UCHL1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-PGP9.5/UCHL1 Antibody Picoband®

Question

Would anti-PGP9.5/UCHL1 antibody PB9840 work on pig WB with cajal-retzius cell fetal brain cortex?

W. Miller

Verified customer

Asked: 2020-04-09

Answer

Our lab technicians have not validated anti-PGP9.5/UCHL1 antibody PB9840 on pig. You can run a BLAST between pig and the immunogen sequence of anti-PGP9.5/UCHL1 antibody PB9840 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig cajal-retzius cell fetal brain cortex in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-09

Question

Would PB9840 anti-PGP9.5/UCHL1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-03-18

Answer

It shows on the product datasheet, PB9840 anti-PGP9.5/UCHL1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-03-18

Question

I see that the anti-PGP9.5/UCHL1 antibody PB9840 works with WB, what is the protocol used to produce the result images on the product page?

G. Baker

Verified customer

Asked: 2020-03-09

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2020-03-09

Question

We have observed staining in human lung muscle. Do you have any suggestions? Is anti-PGP9.5/UCHL1 antibody supposed to stain lung muscle positively?

Verified Customer

Verified customer

Asked: 2020-02-21

Answer

From literature lung muscle does express UCHL1. From Uniprot.org, UCHL1 is expressed in anterior cingulate cortex, lung muscle, brain, cajal-retzius cell fetal brain cortex, among other tissues. Regarding which tissues have UCHL1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 2947814
Lung, and Muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-02-21

Question

We ordered your anti-PGP9.5/UCHL1 antibody for IHC on anterior cingulate cortex a few years ago. I am using mouse, and We intend to use the antibody for WB next. I am interested in examining anterior cingulate cortex as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2019-12-24

Answer

I have checked the website and datasheets of our anti-PGP9.5/UCHL1 antibody and it seems that PB9840 has been validated on mouse in both IHC and WB. Thus PB9840 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-12-24

Question

Our team were content with the WB result of your anti-PGP9.5/UCHL1 antibody. However we have seen positive staining in anterior cingulate cortex cytoplasm. using this antibody. Is that expected? Could you tell me where is UCHL1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-12

Answer

From literature, anterior cingulate cortex does express UCHL1. Generally UCHL1 expresses in cytoplasm. Regarding which tissues have UCHL1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 2947814
Lung, and Muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-12-12

Question

Is a blocking peptide available for product anti-PGP9.5/UCHL1 antibody (PB9840)?

Verified Customer

Verified customer

Asked: 2019-10-30

Answer

We do provide the blocking peptide for product anti-PGP9.5/UCHL1 antibody (PB9840). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-10-30

Question

Is there a BSA free version of anti-PGP9.5/UCHL1 antibody PB9840 available?

Verified Customer

Verified customer

Asked: 2019-10-14

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PGP9.5/UCHL1 antibody PB9840 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-10-14

Question

I was wanting to use your anti-PGP9.5/UCHL1 antibody for WB for mouse lung muscle on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung muscle identification?

Verified Customer

Verified customer

Asked: 2019-10-10

Answer

You can see on the product datasheet, PB9840 anti-PGP9.5/UCHL1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung muscle in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-10

Question

Is this PB9840 anti-PGP9.5/UCHL1 antibody reactive to the isotypes of UCHL1?

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

The immunogen of PB9840 anti-PGP9.5/UCHL1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-11

Question

Please see the WB image, lot number and protocol we used for lung muscle using anti-PGP9.5/UCHL1 antibody PB9840. Please let me know if you require anything else.

S. Walker

Verified customer

Asked: 2019-06-03

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-03

Question

I was wanting to use using your anti-PGP9.5/UCHL1 antibody for adult walking behavior studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

We appreciate your inquiry. This PB9840 anti-PGP9.5/UCHL1 antibody is tested on rat brain tissue, tissue lysate, mouse brain, u87 whole cell lysate, human glioma tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-05-27

Question

Does anti-PGP9.5/UCHL1 antibody PB9840 work for WB with lung muscle?

Verified Customer

Verified customer

Asked: 2019-05-17

Answer

According to the expression profile of lung muscle, UCHL1 is highly expressed in lung muscle. So, it is likely that anti-PGP9.5/UCHL1 antibody PB9840 will work for WB with lung muscle.

Boster Scientific Support

Answered: 2019-05-17

Question

Our lab want to know about to test anti-PGP9.5/UCHL1 antibody PB9840 on mouse lung muscle for research purposes, then I may be interested in using anti-PGP9.5/UCHL1 antibody PB9840 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-04-03

Answer

The products we sell, including anti-PGP9.5/UCHL1 antibody PB9840, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-04-03

Question

My question regarding product PB9840, anti-PGP9.5/UCHL1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-11-16

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9840 anti-PGP9.5/UCHL1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-11-16

Question

We are currently using anti-PGP9.5/UCHL1 antibody PB9840 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?

E. Miller

Verified customer

Asked: 2018-04-19

Answer

The anti-PGP9.5/UCHL1 antibody (PB9840) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-04-19

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung muscle using anti-PGP9.5/UCHL1 antibody PB9840. Let me know if you need anything else.

T. Rodriguez

Verified customer

Asked: 2016-01-05

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-01-05

Order DetailsPrice
PB9840

100μg

$370
PB9840-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9840-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9840-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9840-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9840-APC

100 μg APC conjugated (liquid)

$820
PB9840-FITC

100 μg FITC conjugated (liquid)

$570
PB9840-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9840-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9840-HRP

100 μg HRP conjugated (liquid)

$570
PB9840-PE

100 μg PE conjugated (liquid)

$820
PB9840-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9840
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 29, 2026