Anti-SARS-CoV-2 NSP9 Antibody

rep antibody

Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog # A30395. Tested in ELISA applications. This antibody reacts with Human.

Product Info Summary

SKU: A30395
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: ELISA

Customers Who Bought This Also Bought

Product Name

Anti-SARS-CoV-2 NSP9 Antibody

View all rep Antibodies

SKU/Catalog Number

A30395

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog # A30395. Tested in ELISA applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SARS-CoV-2 NSP9 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A30395)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Reactive Species

A30395 is reactive to rep in Human

Background of rep

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A30395 is guaranteed for ELISA Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
ELISA0.001-0.1μg/mlHuman

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-SARS-CoV-2 NSP9 Antibody?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-SARS-CoV-2 NSP9 Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-SARS-CoV-2 NSP9 Antibody

Order DetailsPrice
A30395

100μg

$415
A30395-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$615
A30395-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$615
A30395-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$615
A30395-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$715
A30395-APC

100 μg APC conjugated (liquid)

$865
A30395-FITC

100 μg FITC conjugated (liquid)

$615
A30395-Cy3

100 μg Cy3 conjugated (liquid)

$615
A30395-Biotin

100 μg Biotin conjugated (liquid)

$615
A30395-HRP

100 μg HRP conjugated (liquid)

$615
A30395-PE

100 μg PE conjugated (liquid)

$865
A30395-carrier-free

Carrier Free

$415
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A30395
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$415.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 7, 2026