ATG4C (NM_178221) Human Recombinant Protein

ATG4C protein,

Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8

Product Info Summary

SKU: PROTQ96DT6
Size: 20 µg
Source: HEK293T

Product Name

ATG4C (NM_178221) Human Recombinant Protein

View all ATG4C recombinant proteins

SKU/Catalog Number

PROTQ96DT6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ATG4C (NM_178221) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96DT6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

52.497kDa

Amino Acid Sequence

MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL

Validation Images & Assay Conditions

Gene/Protein Information For ATG4C (Source: Uniprot.org, NCBI)

Gene Name

ATG4C

Full Name

Cysteine protease ATG4C

Weight

52.497kDa

Superfamily

peptidase C54 family

Alternative Names

APG4 autophagy 4 homolog C (S. cerevisiae); APG4 autophagy 4 homolog C; APG4C; ATG4 autophagy related 4 homolog C (S. cerevisiae); AUT (S. cerevisiae)-like 1, cysteine endopeptidase; AUT-like 1, cysteineendopeptidase (S. cerevisiae); AUTL1; AUTL3APG4-C; AUT-like 1, cysteine endopeptidase; AUT-like 3 cysteine endopeptidase; autophagin-3; Autophagy-related cysteine endopeptidase 3; Autophagy-related protein 4 homolog C; cysteine protease ATG4C; EC 3.4.22; EC 3.4.22.-; FLJ14867 ATG4C APG4-C, APG4C, AUTL1, AUTL3 autophagy related 4C cysteine peptidase cysteine protease ATG4C|APG4 autophagy 4 homolog C|ATG4 autophagy related 4 homolog C|AUT-like 1, cysteine endopeptidase|AUT-like 3 cysteine endopeptidase|autophagin-3|autophagy-related cysteine endopeptidase 3|autophagy-related protein 4 homolog C|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATG4C, check out the ATG4C Infographic

ATG4C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATG4C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96DT6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATG4C (NM_178221) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ATG4C (NM_178221) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATG4C (NM_178221) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96DT6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.