C20orf4 (AAR2) (NM_015511) Human Recombinant Protein

AAR2 protein,

Recombinant protein of human chromosome 20 open reading frame 4 (C20orf4)

Product Info Summary

SKU: PROTQ9Y312
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C20orf4 (AAR2) (NM_015511) Human Recombinant Protein

View all AAR2 recombinant proteins

SKU/Catalog Number

PROTQ9Y312

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 20 open reading frame 4 (C20orf4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

C20orf4 (AAR2) (NM_015511) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y312)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.472kDa

Amino Acid Sequence

MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFISEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSELPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNLLCRSEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDATLRKKAEKFQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG

Validation Images & Assay Conditions

Gene/Protein Information For AAR2 (Source: Uniprot.org, NCBI)

Gene Name

AAR2

Full Name

Protein AAR2 homolog

Weight

43.472kDa

Superfamily

AAR2 family

Alternative Names

AAR2 splicing factor homolog (S. cerevisiae); bA234K24.2; C20orf4; CGI-23; chromosome 20 open reading frame 4; DKFZp564N1363; hypothetical protein LOC25980 AAR2 C20orf4, CGI-23 AAR2 splicing factor protein AAR2 homolog|AAR2 splicing factor homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AAR2, check out the AAR2 Infographic

AAR2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AAR2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y312

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C20orf4 (AAR2) (NM_015511) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C20orf4 (AAR2) (NM_015511) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C20orf4 (AAR2) (NM_015511) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y312
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.