LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein

LIGHT/TNFSF14 protein,

Product Info Summary

SKU: PROTO43557
Size: 20 µg
Source: HEK293T

Product Name

LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein

View all LIGHT/TNFSF14 recombinant proteins

SKU/Catalog Number

PROTO43557

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43557)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.35kDa

Amino Acid Sequence

MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Validation Images & Assay Conditions

Gene/Protein Information For TNFSF14 (Source: Uniprot.org, NCBI)

Gene Name

TNFSF14

Full Name

Tumor necrosis factor ligand superfamily member 14

Weight

26.35kDa

Superfamily

tumor necrosis factor family

Alternative Names

CD258 antigen; CD258; delta transmembrane LIGHT; Herpes virus entry mediator ligand; Herpesvirus entry mediator ligand; HVEM-L; HVEMLherpesvirus entry mediator-ligand; ligand for herpesvirus entry mediator; LIGHT; LIGHTherpesvirus entry mediator A; LTg; TNFSF14; TR2; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; tumor necrosis factor receptor-like 2; tumor necrosis factor superfamily member LIGHT TNFSF14 CD258, HVEML, LIGHT, LTg TNF superfamily member 14 tumor necrosis factor ligand superfamily member 14|herpesvirus entry mediator ligand|tumor necrosis factor (ligand) superfamily, member 14|tumor necrosis factor ligand 1D|tumor necrosis factor superfamily member 14

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFSF14, check out the TNFSF14 Infographic

TNFSF14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFSF14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43557

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43557
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.