Anti-SI Antibody Picoband™

Boster Bio Anti-SI Antibody Picoband™ catalog # A04542-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A04542-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-SI Antibody Picoband™

See all SI Sucrase-Isomaltase products

SKU/Catalog Number







Boster Bio Anti-SI Antibody Picoband™ catalog # A04542-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SI Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04542-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A04542-1 is reactive to SI in Human, Mouse, Rat


A04542-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For SI (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Sucrase-isomaltase, intestinal




glycosyl hydrolase 31 family

Alternative Names

EC; MGC131621; MGC131622; oligosaccharide alpha-1,6-glucosidase; sucrase-isomaltase (alpha-glucosidase); sucrase-isomaltase; sucrase-isomaltase, intestinal SI sucrase-isomaltase sucrase-isomaltase, intestinal|Alpha-methylglucosidase|Oligo-1,6-glucosidase|alpha-glucosidase|oligosaccharide alpha-1,6-glucosidase

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SI, check out the SI Infographic

SI infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SI: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A04542-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SI Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SI Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-SI Antibody Picoband™


My question regarding product A04542-1, anti-SI antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-04-10


We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04542-1 anti-SI antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-10


I see that the anti-SI antibody A04542-1 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-03-24


You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-03-24


We are currently using anti-SI antibody A04542-1 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-08


The anti-SI antibody (A04542-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-08


Does A04542-1 anti-SI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-01-02


It shows on the product datasheet, A04542-1 anti-SI antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-01-02


I was wanting to use to test anti-SI antibody A04542-1 on mouse jejunal mucosa for research purposes, then I may be interested in using anti-SI antibody A04542-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-11-13


The products we sell, including anti-SI antibody A04542-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-13


Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for jejunal mucosa using anti-SI antibody A04542-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-08


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-08


See attached the WB image, lot number and protocol we used for jejunal mucosa using anti-SI antibody A04542-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-04-12


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-12


Is a blocking peptide available for product anti-SI antibody (A04542-1)?

Verified Customer

Verified customer

Asked: 2018-12-18


We do provide the blocking peptide for product anti-SI antibody (A04542-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-12-18


I was wanting to use your anti-SI antibody for IHC for mouse jejunal mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse jejunal mucosa identification?

Verified Customer

Verified customer

Asked: 2018-08-28


You can see on the product datasheet, A04542-1 anti-SI antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse jejunal mucosa in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-08-28


Does anti-SI antibody A04542-1 work on feline IHC with intestine?

F. Krishna

Verified customer

Asked: 2015-07-30


Our lab technicians have not validated anti-SI antibody A04542-1 on feline. You can run a BLAST between feline and the immunogen sequence of anti-SI antibody A04542-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline intestine in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-07-30


Is this A04542-1 anti-SI antibody reactive to the isotypes of SI?

C. Taylor

Verified customer

Asked: 2014-11-28


The immunogen of A04542-1 anti-SI antibody is A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-11-28


Does anti-SI antibody A04542-1 work for IHC with jejunal mucosa?

K. Huang

Verified customer

Asked: 2014-11-14


According to the expression profile of jejunal mucosa, SI is highly expressed in jejunal mucosa. So, it is likely that anti-SI antibody A04542-1 will work for IHC with jejunal mucosa.

Boster Scientific Support

Answered: 2014-11-14


Do you have a BSA free version of anti-SI antibody A04542-1 available?

S. Collins

Verified customer

Asked: 2013-03-06


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SI antibody A04542-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-03-06


how to order through PO

Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.