Product Info Summary
SKU: | A04542-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SI Antibody Picoband™
View all SI Sucrase-Isomaltase Antibodies
SKU/Catalog Number
A04542-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SI Antibody Picoband™ catalog # A04542-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SI Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04542-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SI, which shares 86.1% amino acid (aa) sequence identity with rat SI.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04542-1 is reactive to SI in Human, Mouse, Rat
Applications
A04542-1 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
209 kDa
Calculated molecular weight
209.453kDa
Background of SI Sucrase-Isomaltase
This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SI using anti-SI antibody (A04542-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate,
Lane 2: human COLO-320 whole cell lysate,
Lane 3: human SHG-44 whole cell lysate,
Lane 4: human HEK293 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SI antigen affinity purified polyclonal antibody (Catalog # A04542-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SI at approximately 209KD. The expected band size for SI is at 209KD.
Click image to see more details
Figure 2. IHC analysis of SI using anti-SI antibody (A04542-1).
SI was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SI Antibody (A04542-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of SI using anti-SI antibody (A04542-1).
SI was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SI Antibody (A04542-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of SI using anti-SI antibody (A04542-1).
SI was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SI Antibody (A04542-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. Western blot analysis of SI using anti-SI antibody (A04542-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat intestine tissue lysates
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SI antigen affinity purified polyclonal antibody (Catalog # A04542-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SI at approximately 209KD. The expected band size for SI is at 209KD.
Protein Target Info & Infographic
Gene/Protein Information For SI (Source: Uniprot.org, NCBI)
Gene Name
SI
Full Name
Sucrase-isomaltase, intestinal
Weight
209.453kDa
Superfamily
glycosyl hydrolase 31 family
Alternative Names
EC 3.2.1.20; MGC131621; MGC131622; oligosaccharide alpha-1,6-glucosidase; sucrase-isomaltase (alpha-glucosidase); sucrase-isomaltase; sucrase-isomaltase, intestinal SI sucrase-isomaltase sucrase-isomaltase, intestinal|Alpha-methylglucosidase|Oligo-1,6-glucosidase|alpha-glucosidase|oligosaccharide alpha-1,6-glucosidase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SI, check out the SI Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SI Antibody Picoband™ (A04542-1)
Hello CJ!
No publications found for A04542-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SI Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-SI Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-SI Antibody Picoband™
Question
My question regarding product A04542-1, anti-SI antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-04-10
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04542-1 anti-SI antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-04-10
Question
I see that the anti-SI antibody A04542-1 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-03-24
Question
We are currently using anti-SI antibody A04542-1 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-08
Answer
The anti-SI antibody (A04542-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-08
Question
Does A04542-1 anti-SI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-01-02
Answer
It shows on the product datasheet, A04542-1 anti-SI antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-01-02
Question
I was wanting to use to test anti-SI antibody A04542-1 on mouse jejunal mucosa for research purposes, then I may be interested in using anti-SI antibody A04542-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-11-13
Answer
The products we sell, including anti-SI antibody A04542-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-13
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for jejunal mucosa using anti-SI antibody A04542-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-11-08
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-08
Question
See attached the WB image, lot number and protocol we used for jejunal mucosa using anti-SI antibody A04542-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-04-12
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-04-12
Question
Is a blocking peptide available for product anti-SI antibody (A04542-1)?
Verified Customer
Verified customer
Asked: 2018-12-18
Answer
We do provide the blocking peptide for product anti-SI antibody (A04542-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-12-18
Question
I was wanting to use your anti-SI antibody for IHC for mouse jejunal mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse jejunal mucosa identification?
Verified Customer
Verified customer
Asked: 2018-08-28
Answer
You can see on the product datasheet, A04542-1 anti-SI antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse jejunal mucosa in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-08-28
Question
Does anti-SI antibody A04542-1 work on feline IHC with intestine?
F. Krishna
Verified customer
Asked: 2015-07-30
Answer
Our lab technicians have not validated anti-SI antibody A04542-1 on feline. You can run a BLAST between feline and the immunogen sequence of anti-SI antibody A04542-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline intestine in IHC, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-07-30
Question
Is this A04542-1 anti-SI antibody reactive to the isotypes of SI?
C. Taylor
Verified customer
Asked: 2014-11-28
Answer
The immunogen of A04542-1 anti-SI antibody is A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-11-28
Question
Does anti-SI antibody A04542-1 work for IHC with jejunal mucosa?
K. Huang
Verified customer
Asked: 2014-11-14
Answer
According to the expression profile of jejunal mucosa, SI is highly expressed in jejunal mucosa. So, it is likely that anti-SI antibody A04542-1 will work for IHC with jejunal mucosa.
Boster Scientific Support
Answered: 2014-11-14
Question
Do you have a BSA free version of anti-SI antibody A04542-1 available?
S. Collins
Verified customer
Asked: 2013-03-06
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SI antibody A04542-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2013-03-06