MAX (NM_145114) Human Recombinant Protein

MAX protein,

Product Info Summary

SKU: PROTP61244
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MAX (NM_145114) Human Recombinant Protein

View all MAX recombinant proteins

SKU/Catalog Number

PROTP61244

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MYC associated factor X (MAX), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAX (NM_145114) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61244)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.3 kDa

Amino Acid Sequence

MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKLYFLFWKLCTPVLHRQSLMQKCHTFISSYQVHKKKECKI

Validation Images & Assay Conditions

Gene/Protein Information For MAX (Source: Uniprot.org, NCBI)

Gene Name

MAX

Full Name

Protein max

Weight

11.3 kDa

Superfamily

MAX family

Alternative Names

BHLHD4; bHLHd4MGC11225; bHLHd5; bHLHd6; bHLHd7; bHLHd8; Class D basic helix-loop-helix protein 4; helix-loop-helix zipper protein; MAX protein; Max; MGC10775; MGC18164; MGC34679; MGC36767; MYC associated factor X; Myc-associated factor X; orf1; protein max MAX bHLHd4 MYC associated factor X protein max|class D basic helix-loop-helix protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAX, check out the MAX Infographic

MAX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61244

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAX (NM_145114) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAX (NM_145114) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAX (NM_145114) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61244
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.