Click image to see more details
Product Info Summary
| SKU: | R00102-6 |
|---|---|
| Size: | 5 µg/vial |
| Source: | Yeast |
| Application: | Cell Culture |
Product info
Product Name
Mouse IL-6 Recombinant Protein
View all IL6 recombinant proteins
SKU/Catalog Number
R00102-6
Size
5 µg/vial
Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Storage & Handling
Store at -20°C for one year. Avoid repeated freeze-thaw cycles.
Cite This Product
Mouse IL-6 Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00102-6)
Form
Lyophilized
Formulation
Lyophilized without carrier protein.
Purity
Ion-exchange chromatography.
Predicted MW
24.4 kDa
Biological Activity and Protein Authenticity
In testing.
Amino Acid Sequence
FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Specific Publications For Mouse IL-6 Recombinant Protein (R00102-6)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse IL-6 Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse IL-6 Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
