Mouse IL-6 Recombinant Protein

IL6 protein,

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Product Info Summary

SKU: R00102-6
Size: 5 µg/vial
Source: Yeast
Application: Cell Culture

Product Name

Mouse IL-6 Recombinant Protein

View all IL6 recombinant proteins

SKU/Catalog Number

R00102-6

Size

5 µg/vial

Description

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Storage & Handling

Store at -20°C for one year. Avoid repeated freeze-thaw cycles.

Cite This Product

Mouse IL-6 Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00102-6)

Form

Lyophilized

Formulation

Lyophilized without carrier protein.

Purity

Ion-exchange chromatography.

Predicted MW

24.4 kDa

Biological Activity and Protein Authenticity

In testing.

Amino Acid Sequence

FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Mouse IL-6 Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse IL-6 Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse IL-6 Recombinant Protein

$364
Backordered.

Lead time for this item is typically 4 weeks

Get A Quote
In stock
Order Product
R00102-6
$364.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 16, 2026