NENF (NM_013349) Human Recombinant Protein

Neudesin protein,

Product Info Summary

SKU: PROTQ9UMX5
Size: 20 µg
Source: HEK293T

Product Name

NENF (NM_013349) Human Recombinant Protein

View all Neudesin recombinant proteins

SKU/Catalog Number

PROTQ9UMX5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human neuron derived neurotrophic factor (NENF), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NENF (NM_013349) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UMX5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.6 kDa

Amino Acid Sequence

MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

Validation Images & Assay Conditions

Gene/Protein Information For NENF (Source: Uniprot.org, NCBI)

Gene Name

NENF

Full Name

Neudesin

Weight

15.6 kDa

Superfamily

cytochrome b5 family

Alternative Names

Cell immortalization-related protein 2; CIR2; CIR2cell growth-inhibiting protein 47; NENF; Neudesin; neuron derived neurotrophic factor; Neuron-derived neurotrophic factor; SCIRP10; SCIRP10-related protein; Secreted protein of unknown function; Spinal cord injury related protein 10; SPUF protein; SPUF; SPUFneudesin NENF CIR2, SCIRP10, SPUF neudesin neurotrophic factor neudesin|SCIRP10-related protein|Spinal cord injury related protein 10|cell growth-inhibiting protein 47|cell immortalization-related protein 2|neuron-derived neurotrophic factor|secreted protein of unknown function

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NENF, check out the NENF Infographic

NENF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NENF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UMX5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NENF (NM_013349) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NENF (NM_013349) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NENF (NM_013349) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UMX5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.