p16 ARC (ARPC5) (NM_005717) Human Recombinant Protein

ARPC5 protein,

Product Info Summary

SKU: PROTO15511
Size: 20 µg
Source: HEK293T

Product Name

p16 ARC (ARPC5) (NM_005717) Human Recombinant Protein

View all ARPC5 recombinant proteins

SKU/Catalog Number

PROTO15511

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

p16 ARC (ARPC5) (NM_005717) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15511)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.32kDa

Amino Acid Sequence

MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Validation Images & Assay Conditions

Gene/Protein Information For ARPC5 (Source: Uniprot.org, NCBI)

Gene Name

ARPC5

Full Name

Actin-related protein 2/3 complex subunit 5

Weight

16.32kDa

Superfamily

ARPC5 family

Alternative Names

actin related protein 2/3 complex, subunit 5, 16kDa; ARC16subunit 5 (16 kD); MGC88523 ARPC5 ARC16, dJ127C7.3, p16-Arc actin related protein 2/3 complex subunit 5 actin-related protein 2/3 complex subunit 5|Arp2/3 protein complex subunit p16|actin related protein 2/3 complex, subunit 5, 16kDa|arp2/3 complex 16 kDa subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ARPC5, check out the ARPC5 Infographic

ARPC5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ARPC5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15511

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p16 ARC (ARPC5) (NM_005717) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p16 ARC (ARPC5) (NM_005717) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p16 ARC (ARPC5) (NM_005717) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15511
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.