PBX1 (NM_002585) Human Recombinant Protein

PBX1 protein,

Recombinant protein of human pre-B-cell leukemia homeobox 1 (PBX1)

Product Info Summary

SKU: PROTP40424
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PBX1 (NM_002585) Human Recombinant Protein

View all PBX1 recombinant proteins

SKU/Catalog Number

PROTP40424

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pre-B-cell leukemia homeobox 1 (PBX1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PBX1 (NM_002585) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP40424)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.4 kDa

Amino Acid Sequence

MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN

Validation Images & Assay Conditions

Gene/Protein Information For PBX1 (Source: Uniprot.org, NCBI)

Gene Name

PBX1

Full Name

Pre-B-cell leukemia transcription factor 1

Weight

46.4 kDa

Superfamily

TALE/PBX homeobox family

Alternative Names

DKFZp686B09108; Homeobox protein PBX1; Homeobox protein PRL; MGC126627; Pre-B cell leukemia transcription factor-1; pre-B-cell leukemia homeobox 1; pre-B-cell leukemia transcription factor 1; PRL PBX1 CAKUHED PBX homeobox 1 pre-B-cell leukemia transcription factor 1|homeobox protein PBX1|homeobox protein PRL|pre-B-cell leukemia homeobox 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PBX1, check out the PBX1 Infographic

PBX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PBX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP40424

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PBX1 (NM_002585) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PBX1 (NM_002585) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PBX1 (NM_002585) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP40424
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.