Click image to see more details
Product Info Summary
| SKU: | PB9344 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Otx2 Antibody Picoband®
SKU/Catalog Number
PB9344
PB0336 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Otx2 Antibody Picoband® catalog # PB9344. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Otx2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9344)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2, identical to the related mouse sequence.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9344 is reactive to OTX2 in Human
Observed Molecular Weight
37 kDa
Calculated molecular weight
31.6 kDa
Background of OTX2
OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9344 is guaranteed for IHC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Human |
| Immunohistochemistry(Paraffin-embedded Section) | 2-5 μg/ml | Human |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of Otx2 using anti-Otx2 antibody (PB9344).
Electrophoresis was performed on a 10% SDS-PAGE gel at 80V (Stacking gel) / 120V (Resolving gel) for 2 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Y79 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Otx2 antigen affinity purified polyclonal antibody (PB9344) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody (Catalog # BA1054) at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an ECL Plus Western Blotting Substrate (Catalog # AR1196-200) with Tanon 5200 system. A specific band was detected for Otx2 at approximately 37 kDa. The expected band size for Otx2 is at 32 kDa.
Click image to see more details
IHC analysis of Otx2 using anti-Otx2 antibody (PB9344).
Otx2 was detected in a paraffin-embedded section of human cerebral cortex tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-Otx2 Antibody (PB9344) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Specific Publications For Anti-Otx2 Antibody Picoband® (PB9344)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Otx2 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Otx2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Otx2 Antibody Picoband®
Question
I was wanting to use your anti-Otx2 antibody for WB for human eye on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human eye identification?
Verified Customer
Verified customer
Asked: 2020-03-06
Answer
You can see on the product datasheet, PB9344 anti-Otx2 antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human eye in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-03-06
Question
We want to test anti-Otx2 antibody PB9344 on human eye for research purposes, then I may be interested in using anti-Otx2 antibody PB9344 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-10
Answer
The products we sell, including anti-Otx2 antibody PB9344, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-10
Question
We are currently using anti-Otx2 antibody PB9344 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2018-04-03
Answer
The anti-Otx2 antibody (PB9344) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-04-03
Question
Is this PB9344 anti-Otx2 antibody reactive to the isotypes of OTX2?
B. Jones
Verified customer
Asked: 2015-09-15
Answer
The immunogen of PB9344 anti-Otx2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2015-09-15
