RAB9B (NM_016370) Human Recombinant Protein

RAB9B protein,

Recombinant protein of human RAB9B, member RAS oncogene family (RAB9B)

Product Info Summary

SKU: PROTQ9NP90
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAB9B (NM_016370) Human Recombinant Protein

View all RAB9B recombinant proteins

SKU/Catalog Number

PROTQ9NP90

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB9B, member RAS oncogene family (RAB9B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAB9B (NM_016370) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NP90)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.5 kDa

Amino Acid Sequence

MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC

Validation Images & Assay Conditions

Gene/Protein Information For RAB9B (Source: Uniprot.org, NCBI)

Gene Name

RAB9B

Full Name

Ras-related protein Rab-9B

Weight

22.5 kDa

Superfamily

small GTPase superfamily

Alternative Names

RAB9B, member RAS oncogene family; Rab-9L; RAB9-like protein; RAB9LRab-9-like protein; ras-related protein Rab-9B RAB9B RAB9L, Rab-9L RAB9B, member RAS oncogene family ras-related protein Rab-9B|Ras-associated protein 9B|Ras-associated protein RAB9-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAB9B, check out the RAB9B Infographic

RAB9B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB9B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NP90

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAB9B (NM_016370) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAB9B (NM_016370) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAB9B (NM_016370) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NP90
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.