SGK3 (NM_013257) Human Recombinant Protein

SGK3 protein,

Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1

Product Info Summary

SKU: PROTQ96BR1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SGK3 (NM_013257) Human Recombinant Protein

View all SGK3 recombinant proteins

SKU/Catalog Number

PROTQ96BR1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SGK3 (NM_013257) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96BR1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

56.9 kDa

Amino Acid Sequence

MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL

Validation Images & Assay Conditions

Gene/Protein Information For SGK3 (Source: Uniprot.org, NCBI)

Gene Name

SGK3

Full Name

Serine/threonine-protein kinase Sgk3

Weight

56.9 kDa

Superfamily

protein kinase superfamily

Alternative Names

CISK; DKFZp781N0293; EC 2.7.11; EC 2.7.11.1; serine/threonine-protein kinase Sgk3; serum/glucocorticoid regulated kinase 3; serum/glucocorticoid regulated kinase family, member 3; serum/glucocorticoid regulated kinase-like; Serum/glucocorticoid-regulated kinase 3; Serum/glucocorticoid-regulated kinase-like; SGK2; SGKLcytokine-independent survival kinase SGK3 CISK, SGK2, SGKL serum/glucocorticoid regulated kinase family member 3 serine/threonine-protein kinase Sgk3|cytokine-independent survival kinase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SGK3, check out the SGK3 Infographic

SGK3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SGK3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96BR1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SGK3 (NM_013257) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SGK3 (NM_013257) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SGK3 (NM_013257) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96BR1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.