ACTR1A (NM_005736) Human Recombinant Protein

ACTR1A protein,

Recombinant protein of human ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A)

Product Info Summary

SKU: PROTP61163
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ACTR1A (NM_005736) Human Recombinant Protein

View all ACTR1A recombinant proteins

SKU/Catalog Number

PROTP61163

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ACTR1A (NM_005736) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP61163)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.614kDa

Amino Acid Sequence

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ACTR1A (Source: Uniprot.org, NCBI)

Gene Name

ACTR1A

Full Name

Alpha-centractin

Weight

42.614kDa

Superfamily

actin family

Alternative Names

Actin-RPV; alpha-centractin; ARP1 (actin-related protein 1, yeast) homolog A (centractin alpha); ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); ARP1actin-RPV; centractin; Centrosome-associated actin homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002 ACTR1A ARP1, Arp1A, CTRN1 actin related protein 1A alpha-centractin|ARP1 actin related protein 1 homolog A|ARP1 actin-related protein 1 homolog A, centractin alpha|actin-RPV|centractin|centrosome-associated actin homolog|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ACTR1A, check out the ACTR1A Infographic

ACTR1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACTR1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP61163

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ACTR1A (NM_005736) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ACTR1A (NM_005736) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ACTR1A (NM_005736) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP61163
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.