Product Info Summary
| SKU: | A00360-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse |
| Host: | Rabbit |
| Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD47 Antibody Picoband®
SKU/Catalog Number
A00360-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CD47 Antibody Picoband® catalog # A00360-1. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD47 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00360-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CD47, which shares 61.8% and 66.7% amino acid (aa) sequence identity with mouse and rat CD47, respectively.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00360-1 is reactive to CD47 in Human, Mouse
Observed Molecular Weight
50 kDa
Calculated molecular weight
35.2 kDa
Background of CD47
CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00360-1 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Human, Mouse |
| Immunohistochemistry (Paraffin-embedded Section) | 2-5μg/ml | Human |
| Flow Cytometry (Fixed) | 1-3μg/1x106 cells | Human |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of CD47 using anti-CD47 antibody (A00360-1).
Electrophoresis was performed on a 10% SDS-PAGE gel at 80V (Stacking gel) / 120V (Resolving gel) for 2 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human HT1080 whole cell lysates,
Lane 3: human A549 whole cell lysates,
Lane 4: mouse thymus tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD47 antigen affinity purified polyclonal antibody (A00360-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody (Catalog # BA1054) at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an ECL Plus Western Blotting Substrate (Catalog # AR1196-200) with Tanon 5200 system. A specific band was detected for CD47 at approximately 50 kDa. The expected band size for CD47 is at 35 kDa.
Click image to see more details
IHC analysis of CD47 using anti-CD47 antibody (A00360-1).
CD47 was detected in a paraffin-embedded section of human ovarican cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-CD47 Antibody (A00360-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Flow Cytometry analysis of A549 cells using anti-CD47 antibody (A00360-1).
Overlay histogram showing A549 cells stained with A00360-1 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-CD47 Antibody (A00360-1, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Specific Publications For Anti-CD47 Antibody Picoband® (A00360-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD47 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-CD47 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-CD47 Antibody Picoband®
Question
Does A00360-1 anti-CD47 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-03-09
Answer
As indicated on the product datasheet, A00360-1 anti-CD47 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-03-09
Question
I have attached the WB image, lot number and protocol we used for leukemic t-cell using anti-CD47 antibody A00360-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-05
Question
Is a blocking peptide available for product anti-CD47 antibody (A00360-1)?
W. Mitchell
Verified customer
Asked: 2019-11-20
Answer
We do provide the blocking peptide for product anti-CD47 antibody (A00360-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2019-11-20
Question
I see that the anti-CD47 antibody A00360-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-11-14
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-11-14
Question
I have a question about product A00360-1, anti-CD47 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-04
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00360-1 anti-CD47 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-04
Question
We have seen staining in human myelomonocyte. What should we do? Is anti-CD47 antibody supposed to stain myelomonocyte positively?
C. Zhang
Verified customer
Asked: 2019-07-19
Answer
According to literature myelomonocyte does express CD47. According to Uniprot.org, CD47 is expressed in visceral pleura, ovary, myelomonocyte, brain, hippocampus, leiomyosarcoma ovarian adenocarcinoma, erythrocyte, t-cell, liver, leukemic t-cell, among other tissues. Regarding which tissues have CD47 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Erythrocyte, Pubmed ID: 7998989
Hippocampus, Leiomyosarcoma, and Ovarian adenocarcinoma, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19349973
Liver, Pubmed ID: 19159218
Myelomonocyte, Pubmed ID: 7691831
Ovary, Pubmed ID: 1394148
T-cell, Pubmed ID: 15383453
Boster Scientific Support
Answered: 2019-07-19
Question
Is this A00360-1 anti-CD47 antibody reactive to the isotypes of CD47?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
The immunogen of A00360-1 anti-CD47 antibody is A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-02
Question
We are currently using anti-CD47 antibody A00360-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-02-01
Answer
The anti-CD47 antibody (A00360-1) has not been tested for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-02-01
Question
you antibody to test anti-CD47 antibody A00360-1 on human leukemic t-cell for research purposes, then I may be interested in using anti-CD47 antibody A00360-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-03-15
Answer
The products we sell, including anti-CD47 antibody A00360-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-03-15
Question
Is there a BSA free version of anti-CD47 antibody A00360-1 available?
Verified Customer
Verified customer
Asked: 2017-11-29
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CD47 antibody A00360-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-11-29
Question
Will anti-CD47 antibody A00360-1 work on pig WB with visceral pleura?
Verified Customer
Verified customer
Asked: 2017-06-22
Answer
Our lab technicians have not validated anti-CD47 antibody A00360-1 on pig. You can run a BLAST between pig and the immunogen sequence of anti-CD47 antibody A00360-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig visceral pleura in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-06-22
Question
Our team were satisfied with the WB result of your anti-CD47 antibody. However we have seen positive staining in leukemic t-cell cell membrane using this antibody. Is that expected? Could you tell me where is CD47 supposed to be expressed?
T. Carter
Verified customer
Asked: 2016-11-09
Answer
Based on literature, leukemic t-cell does express CD47. Generally CD47 expresses in cell membrane. Regarding which tissues have CD47 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Erythrocyte, Pubmed ID: 7998989
Hippocampus, Leiomyosarcoma, and Ovarian adenocarcinoma, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19349973
Liver, Pubmed ID: 19159218
Myelomonocyte, Pubmed ID: 7691831
Ovary, Pubmed ID: 1394148
T-cell, Pubmed ID: 15383453
Boster Scientific Support
Answered: 2016-11-09
Question
I was wanting to use your anti-CD47 antibody for WB for human leukemic t-cell on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human leukemic t-cell identification?
F. Miller
Verified customer
Asked: 2016-06-09
Answer
You can see on the product datasheet, A00360-1 anti-CD47 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human leukemic t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-06-09
Question
Will anti-CD47 antibody A00360-1 work for WB with leukemic t-cell?
B. Yang
Verified customer
Asked: 2015-07-30
Answer
According to the expression profile of leukemic t-cell, CD47 is highly expressed in leukemic t-cell. So, it is likely that anti-CD47 antibody A00360-1 will work for WB with leukemic t-cell.
Boster Scientific Support
Answered: 2015-07-30
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-CD47 antibody A00360-1. Let me know if you need anything else.
M. Jha
Verified customer
Asked: 2015-02-20
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-02-20


