Product Info Summary
SKU: | A00360-1 |
---|---|
Size: | 100ug/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD47 Antibody Picoband™
SKU/Catalog Number
A00360-1
Size
100ug/vial
Form
Lyophilized
Description
Boster Bio Anti-CD47 Antibody Picoband™ catalog # A00360-1. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD47 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00360-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
A00360-1 is reactive to CD47 in Human
Applications
A00360-1 is guaranteed for WB Boster Guarantee
Background of CD47
CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of CD47 using anti-CD47 antibody (A00360-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human MCF-7 whole cell lysates,
Lane 2: human SK-OV-3 whole cell lysates,
Lane 3: human PANC-1 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD47 antigen affinity purified polyclonal antibody (Catalog # A00360-1) at 0.5 ug/mL overnight at 4?? then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CD47 at approximately 41KD. The expected band size for CD47 is at 35KD.
Protein Target Info & Infographic
Gene/Protein Information For CD47 (Source: Uniprot.Org, NCBI)
Uniprot ID
Q08722
Gene ID
961
Gene Name
CD47
Full Name
Leukocyte surface antigen CD47
Weight
35.214kDa
Alternative Names
antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47; IAP; IAPintegrin associated protein; Integrin-associated protein; leukocyte surface antigen CD47; MER6integrin-associated signal transducer; OA3; Protein MER6; Rh-related antigen CD47 IAP, MER6, OA3 CD47 molecule leukocyte surface antigen CD47|CD47 antigen (Rh-related antigen, integrin-associated signal transducer)|CD47 glycoprotein|Rh-related antigen|antigen identified by monoclonal antibody 1D8|antigenic surface determinant protein OA3|integrin associated protein|integrin-associated signal transducer
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on CD47, check out the CD47 Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for CD47: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-CD47 Antibody Picoband™ (A00360-1)
No publications found for A00360-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD47 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-CD47 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-CD47 Antibody Picoband™
Question
Does A00360-1 anti-CD47 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-03-09
Answer
As indicated on the product datasheet, A00360-1 anti-CD47 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-03-09
Question
I have attached the WB image, lot number and protocol we used for leukemic t-cell using anti-CD47 antibody A00360-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-05
Question
Is a blocking peptide available for product anti-CD47 antibody (A00360-1)?
W. Mitchell
Verified customer
Asked: 2019-11-20
Answer
We do provide the blocking peptide for product anti-CD47 antibody (A00360-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-11-20
Question
I see that the anti-CD47 antibody A00360-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-11-14
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-11-14
Question
I have a question about product A00360-1, anti-CD47 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-04
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00360-1 anti-CD47 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-04
Question
We have seen staining in human myelomonocyte. What should we do? Is anti-CD47 antibody supposed to stain myelomonocyte positively?
C. Zhang
Verified customer
Asked: 2019-07-19
Answer
According to literature myelomonocyte does express CD47. According to Uniprot.org, CD47 is expressed in visceral pleura, ovary, myelomonocyte, brain, hippocampus, leiomyosarcoma ovarian adenocarcinoma, erythrocyte, t-cell, liver, leukemic t-cell, among other tissues. Regarding which tissues have CD47 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Erythrocyte, Pubmed ID: 7998989
Hippocampus, Leiomyosarcoma, and Ovarian adenocarcinoma, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19349973
Liver, Pubmed ID: 19159218
Myelomonocyte, Pubmed ID: 7691831
Ovary, Pubmed ID: 1394148
T-cell, Pubmed ID: 15383453
Boster Scientific Support
Answered: 2019-07-19
Question
Is this A00360-1 anti-CD47 antibody reactive to the isotypes of CD47?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
The immunogen of A00360-1 anti-CD47 antibody is A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-02
Question
We are currently using anti-CD47 antibody A00360-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-02-01
Answer
The anti-CD47 antibody (A00360-1) has not been tested for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-02-01
Question
you antibody to test anti-CD47 antibody A00360-1 on human leukemic t-cell for research purposes, then I may be interested in using anti-CD47 antibody A00360-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-03-15
Answer
The products we sell, including anti-CD47 antibody A00360-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-03-15
Question
Is there a BSA free version of anti-CD47 antibody A00360-1 available?
Verified Customer
Verified customer
Asked: 2017-11-29
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CD47 antibody A00360-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-11-29
Question
Will anti-CD47 antibody A00360-1 work on pig WB with visceral pleura?
Verified Customer
Verified customer
Asked: 2017-06-22
Answer
Our lab technicians have not validated anti-CD47 antibody A00360-1 on pig. You can run a BLAST between pig and the immunogen sequence of anti-CD47 antibody A00360-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig visceral pleura in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-06-22
Question
Our team were satisfied with the WB result of your anti-CD47 antibody. However we have seen positive staining in leukemic t-cell cell membrane using this antibody. Is that expected? Could you tell me where is CD47 supposed to be expressed?
T. Carter
Verified customer
Asked: 2016-11-09
Answer
Based on literature, leukemic t-cell does express CD47. Generally CD47 expresses in cell membrane. Regarding which tissues have CD47 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Erythrocyte, Pubmed ID: 7998989
Hippocampus, Leiomyosarcoma, and Ovarian adenocarcinoma, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19349973
Liver, Pubmed ID: 19159218
Myelomonocyte, Pubmed ID: 7691831
Ovary, Pubmed ID: 1394148
T-cell, Pubmed ID: 15383453
Boster Scientific Support
Answered: 2016-11-09
Question
I was wanting to use your anti-CD47 antibody for WB for human leukemic t-cell on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human leukemic t-cell identification?
F. Miller
Verified customer
Asked: 2016-06-09
Answer
You can see on the product datasheet, A00360-1 anti-CD47 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human leukemic t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-06-09
Question
Will anti-CD47 antibody A00360-1 work for WB with leukemic t-cell?
B. Yang
Verified customer
Asked: 2015-07-30
Answer
According to the expression profile of leukemic t-cell, CD47 is highly expressed in leukemic t-cell. So, it is likely that anti-CD47 antibody A00360-1 will work for WB with leukemic t-cell.
Boster Scientific Support
Answered: 2015-07-30
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-CD47 antibody A00360-1. Let me know if you need anything else.
M. Jha
Verified customer
Asked: 2015-02-20
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-02-20