Anti-Dishevelled/Dvl1 Antibody Picoband™

Product Name

Anti-Dishevelled/Dvl1 Antibody Picoband™

See all Dishevelled-1 products

SKU/Catalog Number

A03533-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Dishevelled/Dvl1 Antibody Picoband™ catalog # A03533-1. Tested in IHC, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Dishevelled/Dvl1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03533-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A03533-1 is reactive to DVL1 in Human, Rat

Applications

A03533-1 is guaranteed for IHC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Rat, Human

Validation Images & Assay Conditions

Click image to see more details

Figure 2. IHC analysis of DVL1 using anti-DVL1 antibody (A03533-1).
DVL1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-DVL1 Antibody (A03533-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.

Click image to see more details

Figure 1. Western blot analysis of DVL1 using anti-DVL1 antibody (A03533-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: rat testis tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-DVL1 antigen affinity purified polyclonal antibody (Catalog # A03533-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for DVL1 at approximately 75KD. The expected band size for DVL1 is at 75KD.

Gene/Protein Information For DVL1 (Source: Uniprot.Org, NCBI)

Alternative Names

dishevelled 1 (homologous to Drosophila dsh); dishevelled, dsh homolog 1 (Drosophila); Dishevelled1; Dishevelled-1; DSH homolog 1; Dsh; DVL; DVL1; DVL1L1; MGC54245; segment polarity protein dishevelled homolog DVL-1 DVL1 DRS2, DVLL1, DVL1P1, DVL1 dishevelled segment polarity protein 1 segment polarity protein dishevelled homolog DVL-1|DSH homolog 1|dishevelled 1 (homologous to Drosophila dsh)|dishevelled, dsh homolog 1|dishevelled-1

For more info on DVL1, check out the DVL1 Infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for DVL1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

Take me to the DVL1 Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis