Anti-Dishevelled/Dvl1 Antibody Picoband™

Boster Bio Anti-Dishevelled/Dvl1 Antibody Picoband™ catalog # A03533-1. Tested in IHC, WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: A03533-1
Size: 100μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Dishevelled/Dvl1 Antibody Picoband™

See all Dishevelled-1 products

SKU/Catalog Number

A03533-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Dishevelled/Dvl1 Antibody Picoband™ catalog # A03533-1. Tested in IHC, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Dishevelled/Dvl1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03533-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A03533-1 is reactive to DVL1 in Human, Rat

Applications

A03533-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For DVL1 (Source: Uniprot.Org, NCBI)

Uniprot ID

O14640

Gene ID

1855

Gene Name

DVL1

Full Name

Segment polarity protein dishevelled homolog DVL-1

Weight

75.187kDa

Superfamily

DSH family

Alternative Names

dishevelled 1 (homologous to Drosophila dsh); dishevelled, dsh homolog 1 (Drosophila); Dishevelled1; Dishevelled-1; DSH homolog 1; Dsh; DVL; DVL1; DVL1L1; MGC54245; segment polarity protein dishevelled homolog DVL-1 DVL1 DRS2, DVLL1, DVL1P1, DVL1 dishevelled segment polarity protein 1 segment polarity protein dishevelled homolog DVL-1|DSH homolog 1|dishevelled 1 (homologous to Drosophila dsh)|dishevelled, dsh homolog 1|dishevelled-1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on DVL1, check out the DVL1 Infographic

DVL1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for DVL1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A03533-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Dishevelled/Dvl1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Dishevelled/Dvl1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-Dishevelled/Dvl1 Antibody Picoband™

Question

We are currently using anti-Dishevelled/Dvl1 antibody A03533-1 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-10

Answer

The anti-Dishevelled/Dvl1 antibody (A03533-1) has not been tested for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-10

Question

I see that the anti-Dishevelled/Dvl1 antibody A03533-1 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-01-23

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-01-23

Question

I am interested in to test anti-Dishevelled/Dvl1 antibody A03533-1 on human gastrocnemius for research purposes, then I may be interested in using anti-Dishevelled/Dvl1 antibody A03533-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-11-15

Answer

The products we sell, including anti-Dishevelled/Dvl1 antibody A03533-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-15

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A03533-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.