Overview
Product Name |
Anti-Dishevelled/Dvl1 Antibody Picoband™
See more Dishevelled-1 products |
Catalog# |
A03533-1 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-Dishevelled/Dvl1 Antibody Picoband™ catalog # A03533-1. Tested in IHC, WB applications. This antibody reacts with Human, Rat. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-Dishevelled/Dvl1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03533-1)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-Dishevelled/Dvl1 Antibody Picoband™ may replace the following items: sc 8025|sc 133525|sc 25534|sc 7400|sc 7397|sc 166303|sc 15690|sc 28647. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human, Rat |
Applications |
IHC, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid. |
Cross Reactivity |
No cross reactivity with other proteins |
Gene/Protein Basic Information For DVL1 (Source: Uniprot.org, NCBI)
Uniprot Id | O14640 |
---|
NCBI Gene Id | 1855 |
---|
Species Of This Entry | Human |
---|
Gene Name | DVL1 |
---|
Protein Name | Segment polarity protein dishevelled homolog DVL-1 |
---|
Superfamily | DSH family |
---|
Alternative Names | Dishevelled-1|dishevelled 1 (homologous to Drosophila dsh); dishevelled, dsh homolog 1 (Drosophila); Dishevelled1; Dishevelled-1; DSH homolog 1; Dsh; DVL; DVL1; DVL1L1; MGC54245; segment polarity protein dishevelled homolog DVL-1 |
---|
Molecular Weight | 75187 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on DVL1, check out the DVL1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for DVL1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the DVL1 infographic
Our Boster Quality Guarantee for Anti-Dishevelled/Dvl1 Antibody Picoband™ covers its use in the following applications.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Rat, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.
Figure 2. IHC analysis of DVL1 using anti-DVL1 antibody (A03533-1).
DVL1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-DVL1 Antibody (A03533-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.

Figure 1. Western blot analysis of DVL1 using anti-DVL1 antibody (A03533-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: rat testis tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-DVL1 antigen affinity purified polyclonal antibody (Catalog # A03533-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for DVL1 at approximately 75KD. The expected band size for DVL1 is at 75KD.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A03533-1 Anti-Dishevelled/Dvl1 Antibody Picoband™
3 Related Questions
Question
We are currently using anti-Dishevelled/Dvl1 antibody A03533-1 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on bovine tissues as well?
Verified Customer
Asked: 2020-03-10
Answer
The anti-Dishevelled/Dvl1 antibody (A03533-1) has not been tested for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-03-10
Question
I see that the anti-Dishevelled/Dvl1 antibody A03533-1 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Asked: 2020-01-23
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-01-23
Question
I am interested in to test anti-Dishevelled/Dvl1 antibody A03533-1 on human gastrocnemius for research purposes, then I may be interested in using anti-Dishevelled/Dvl1 antibody A03533-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Asked: 2019-11-15
Answer
The products we sell, including anti-Dishevelled/Dvl1 antibody A03533-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-15