Product Info Summary
| SKU: | A00714 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Emerin/EMD Antibody Picoband®
SKU/Catalog Number
A00714
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Emerin/EMD Antibody Picoband® catalog # A00714. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Emerin/EMD Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00714)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin, different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A00714 is reactive to EMD in Human, Mouse, Rat
Observed Molecular Weight
34 kDa
Calculated molecular weight
29.0 kDa
Background of EMD
Emerin is a serine-rich nuclear membrane protein that in humans is encoded by the EMD gene. And this gene is mapped to Xq28. Emerin is a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Emery–Dreifuss muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the EMD (also known clinically as STA) gene. Emerin appears to be involved in mechanotransduction, as emerin-deficient mouse fibroblasts failed to transduce normal mechanosensitive gene expression responses to strain stimuli. In cardiac muscle, emerin is also found complexed to beta-catenin at adherens junctions of intercalated discs, and cardiomyocytes from hearts lacking emerin showed beta-catenin redistribution as well as perturbed intercalated disc architecture and myocyte shape. This interaction appears to be regulated by glycogen synthase kinase 3 beta.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00714 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat |
| Immunohistochemistry (Paraffin-embedded Section) | 0.5-1μg/ml | Human |
| Immunofluorescence | 2μg/ml | Human |
| Immunocytochemistry/Immunofluorescence | 2μg/ml | Human |
| Flow Cytometry (Fixed) | 1-3μg/1x106 cells | Human |
Note: For flow cytometry (FCM), validated for fixed cells only. Not validated for FACS or surface flow cytometry using live cells.
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of Emerin using anti-Emerin antibody (A00714).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human 293T whole cell lysates,
Lane 3: rat NRK whole cell lysates,
Lane 4: rat C6 whole cell lysates,
Lane 5: mouse NIH/3T3 whole cell lysates,
Lane 6: mouse Neuro-2a whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Emerin antigen affinity purified polyclonal antibody (Catalog # A00714) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Emerin at approximately 34 kDa. The expected band size for Emerin is at 29 kDa.
Click image to see more details
IHC analysis of Emerin using anti-Emerin antibody (A00714).
Emerin was detected in paraffin-embedded section of human endometrial carcinoma tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Emerin Antibody (A00714) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
IHC analysis of Emerin using anti-Emerin antibody (A00714).
Emerin was detected in paraffin-embedded section of human colon cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Emerin Antibody (A00714) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
IHC analysis of Emerin using anti-Emerin antibody (A00714).
Emerin was detected in paraffin-embedded section of human oesophagus squama cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Emerin Antibody (A00714) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
IF analysis of Emerin using anti-Emerin antibody (A00714)
Emerin was detected in paraffin-embedded section of human oesophagus squama cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-Emerin Antibody (A00714) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
IF analysis of Emerin using anti-Emerin antibody (A00714)
Emerin was detected in paraffin-embedded section of human oesophagus squama cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/mL rabbit anti-Emerin Antibody (A00714) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
IF analysis of Emerin using anti-Emerin antibody (A00714).
Emerin was detected in immunocytochemical section of U20S cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-Emerin Antibody (A00714) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
IF analysis of Emerin using anti-Emerin antibody (A00714).
Emerin was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/mL rabbit anti-Emerin Antibody (A00714) overnight at 4°C. Biotin conjugated goat anti-rabbit IgG (BA1003) was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using DyLight®488 Conjugated Avidin (BA1128). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Flow Cytometry analysis of U20S cells using anti-Emerin antibody (A00714).
Overlay histogram showing U20S cells stained with A00714 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Emerin Antibody (A00714,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Specific Publications For Anti-Emerin/EMD Antibody Picoband® (A00714)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Emerin/EMD Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Emerin/EMD Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Emerin/EMD Antibody Picoband®
Question
My team were happy with the WB result of your anti-Emerin/EMD antibody. However we have seen positive staining in leukemic t-cell nucleus inner membrane using this antibody. Is that expected? Could you tell me where is EMD supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-04-14
Answer
From what I have seen in literature, leukemic t-cell does express EMD. Generally EMD expresses in nucleus inner membrane. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480
Boster Scientific Support
Answered: 2020-04-14
Question
I am looking for using your anti-Emerin/EMD antibody for muscle organ development studies. Has this antibody been tested with western blotting on mouse cardiac muscle tissue lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2020-03-12
Answer
Thank you for your inquiry. This A00714 anti-Emerin/EMD antibody is tested on rat skeletal muscle tissue, mouse cardiac muscle tissue lysates, hela whole cell lysates, u20s cells. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-03-12
Question
We have been able to see staining in rat esophagogastric junction muscularis propria. Do you have any suggestions? Is anti-Emerin/EMD antibody supposed to stain esophagogastric junction muscularis propria positively?
Verified Customer
Verified customer
Asked: 2020-01-28
Answer
From literature esophagogastric junction muscularis propria does express EMD. From Uniprot.org, EMD is expressed in esophagogastric junction muscularis propria, teratocarcinoma, placenta, platelet, cervix carcinoma embryonic kidney, leukemic t-cell, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have EMD expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18220336, 18669648, 18691976, 20068231
Cervix carcinoma, and Embryonic kidney, Pubmed ID: 9673989
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 15489334
Platelet, Pubmed ID: 12665801
Teratocarcinoma, Pubmed ID: 7894480
Boster Scientific Support
Answered: 2020-01-28
Question
I am interested in to test anti-Emerin/EMD antibody A00714 on rat leukemic t-cell for research purposes, then I may be interested in using anti-Emerin/EMD antibody A00714 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-12-18
Answer
The products we sell, including anti-Emerin/EMD antibody A00714, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-12-18
Question
I was wanting to use your anti-Emerin/EMD antibody for IHC-P for rat leukemic t-cell on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat leukemic t-cell identification?
Verified Customer
Verified customer
Asked: 2019-09-17
Answer
You can see on the product datasheet, A00714 anti-Emerin/EMD antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat leukemic t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-17
Question
Here is the WB image, lot number and protocol we used for leukemic t-cell using anti-Emerin/EMD antibody A00714. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-08-14
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-14
Question
My question regarding product A00714, anti-Emerin/EMD antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-12
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00714 anti-Emerin/EMD antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-12
Question
I see that the anti-Emerin/EMD antibody A00714 works with IHC-P, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-03-06
Answer
You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-03-06
Question
We are currently using anti-Emerin/EMD antibody A00714 for mouse tissue, and we are satisfied with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2018-07-11
Answer
The anti-Emerin/EMD antibody (A00714) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-07-11
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-Emerin/EMD antibody A00714. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-05-30
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-05-30
Question
We bought anti-Emerin/EMD antibody for ICC on cervix carcinoma erythroleukemia last year. I am using mouse, and We intend to use the antibody for IHC-F next. We need examining cervix carcinoma erythroleukemia as well as platelet in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC-F?
Verified Customer
Verified customer
Asked: 2018-04-11
Answer
I viewed the website and datasheets of our anti-Emerin/EMD antibody and I see that A00714 has been validated on mouse in both ICC and IHC-F. Thus A00714 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC-F in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC-F detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-04-11
Question
Is a blocking peptide available for product anti-Emerin/EMD antibody (A00714)?
Verified Customer
Verified customer
Asked: 2017-10-27
Answer
We do provide the blocking peptide for product anti-Emerin/EMD antibody (A00714). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2017-10-27
Question
Will A00714 anti-Emerin/EMD antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-08-07
Answer
You can see on the product datasheet, A00714 anti-Emerin/EMD antibody as been validated on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-08-07
Question
Is this A00714 anti-Emerin/EMD antibody reactive to the isotypes of EMD?
Verified Customer
Verified customer
Asked: 2017-06-05
Answer
The immunogen of A00714 anti-Emerin/EMD antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-06-05
Question
Do you have a BSA free version of anti-Emerin/EMD antibody A00714 available?
M. Bhatt
Verified customer
Asked: 2014-01-01
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Emerin/EMD antibody A00714 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-01-01
Question
Does anti-Emerin/EMD antibody A00714 work for IHC-P with leukemic t-cell?
S. Johnson
Verified customer
Asked: 2013-09-23
Answer
According to the expression profile of leukemic t-cell, EMD is highly expressed in leukemic t-cell. So, it is likely that anti-Emerin/EMD antibody A00714 will work for IHC-P with leukemic t-cell.
Boster Scientific Support
Answered: 2013-09-23

