Anti-FDCSP Antibody

FDCSP antibody

Boster Bio Anti-FDCSP Antibody catalog # A13093-1. Tested in IHC, IF applications. This antibody reacts with Human. Cited in 2 publication(s).

Product Info Summary

SKU: A13093-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IF, IHC

Customers Who Bought This Also Bought

Product Name

Anti-FDCSP Antibody

View all FDCSP Antibodies

SKU/Catalog Number

A13093-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-FDCSP Antibody catalog # A13093-1. Tested in IHC, IF applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-FDCSP Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A13093-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human FDCSP.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A13093-1 is reactive to FDCSP in Human

Calculated molecular weight

9.7 kDa

Background of FDCSP

FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A13093-1 is guaranteed for IF, IHC Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human
Immunofluorescence, 5 μg/ml, Human

Positive Control

FDCSP antibody was positively detected by IHC in:
human tonsil tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
FDCSP antibody was positively detected by IF in:
human tonsil tissue

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-FDCSP Antibody?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-FDCSP Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-FDCSP Antibody

Question

Will anti-FDCSP antibody A13093-1 work for IHC with minor salivary gland?

Verified Customer

Verified customer

Asked: 2020-02-03

Answer

According to the expression profile of minor salivary gland, FDCSP is highly expressed in minor salivary gland. So, it is likely that anti-FDCSP antibody A13093-1 will work for IHC with minor salivary gland.

Boster Scientific Support

Answered: 2020-02-03

Question

We are currently using anti-FDCSP antibody A13093-1 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-01-22

Answer

The anti-FDCSP antibody (A13093-1) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-01-22

Question

Is this A13093-1 anti-FDCSP antibody reactive to the isotypes of FDCSP?

Verified Customer

Verified customer

Asked: 2018-12-04

Answer

The immunogen of A13093-1 anti-FDCSP antibody is A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-12-04

Question

I was wanting to use to test anti-FDCSP antibody A13093-1 on human minor salivary gland for research purposes, then I may be interested in using anti-FDCSP antibody A13093-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-11-02

Answer

The products we sell, including anti-FDCSP antibody A13093-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-11-02

Question

My question regarding product A13093-1, anti-FDCSP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-09-24

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A13093-1 anti-FDCSP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-24

Order DetailsPrice
A13093-1

100μg

$370
A13093-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A13093-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A13093-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A13093-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A13093-1-APC

100 μg APC conjugated (liquid)

$820
A13093-1-FITC

100 μg FITC conjugated (liquid)

$570
A13093-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A13093-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A13093-1-HRP

100 μg HRP conjugated (liquid)

$570
A13093-1-PE

100 μg PE conjugated (liquid)

$820
A13093-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A13093-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 4, 2026