Anti-FDCSP Antibody Picoband™

Boster Bio Anti-FDCSP Antibody Picoband™ catalog # A13093-1. Tested in IHC applications. This antibody reacts with Human.

Product Info Summary

SKU: A13093-1
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC

Product Name

Anti-FDCSP Antibody Picoband™

See all FDCSP products

SKU/Catalog Number







Boster Bio Anti-FDCSP Antibody Picoband™ catalog # A13093-1. Tested in IHC applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-FDCSP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A13093-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A13093-1 is reactive to FDCSP in Human


A13093-1 is guaranteed for IHC Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For FDCSP (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Follicular dendritic cell secreted peptide



Alternative Names

C4orf7; chromosome 4 open reading frame 7; FDCSP; FDC-SP; FDC-SPFDC secreted protein; follicular dendritic cell secreted peptide; MGC71894 FDCSP C4orf7, FDC-SP follicular dendritic cell secreted protein follicular dendritic cell secreted peptide|FDC secreted protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on FDCSP, check out the FDCSP Infographic

FDCSP infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for FDCSP: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A13093-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-FDCSP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-FDCSP Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-FDCSP Antibody Picoband™


Will anti-FDCSP antibody A13093-1 work for IHC with minor salivary gland?

Verified Customer

Verified customer

Asked: 2020-02-03


According to the expression profile of minor salivary gland, FDCSP is highly expressed in minor salivary gland. So, it is likely that anti-FDCSP antibody A13093-1 will work for IHC with minor salivary gland.

Boster Scientific Support

Answered: 2020-02-03


We are currently using anti-FDCSP antibody A13093-1 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-01-22


The anti-FDCSP antibody (A13093-1) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-01-22


Is this A13093-1 anti-FDCSP antibody reactive to the isotypes of FDCSP?

Verified Customer

Verified customer

Asked: 2018-12-04


The immunogen of A13093-1 anti-FDCSP antibody is A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-12-04


I was wanting to use to test anti-FDCSP antibody A13093-1 on human minor salivary gland for research purposes, then I may be interested in using anti-FDCSP antibody A13093-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-11-02


The products we sell, including anti-FDCSP antibody A13093-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-11-02


My question regarding product A13093-1, anti-FDCSP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-09-24


We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A13093-1 anti-FDCSP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-24



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.