Anti-FDCSP Antibody Picoband™

FDCSP antibody

Boster Bio Anti-FDCSP Antibody Picoband™ catalog # A13093-1. Tested in IHC, IF applications. This antibody reacts with Human. Cited in 2 publication(s).

Product Info Summary

SKU: A13093-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IF, IHC

Product Name

Anti-FDCSP Antibody Picoband™

View all FDCSP Antibodies

SKU/Catalog Number

A13093-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-FDCSP Antibody Picoband™ catalog # A13093-1. Tested in IHC, IF applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-FDCSP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A13093-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human FDCSP.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A13093-1 is reactive to FDCSP in Human

Applications

A13093-1 is guaranteed for IF, IHC Boster Guarantee

Observed Molecular Weight

28 kDa

Calculated molecular weight

9.7kDa

Background of FDCSP

FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunofluorescence, 5 μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For FDCSP (Source: Uniprot.org, NCBI)

Gene Name

FDCSP

Full Name

Follicular dendritic cell secreted peptide

Weight

9.7kDa

Alternative Names

C4orf7; chromosome 4 open reading frame 7; FDCSP; FDC-SP; FDC-SPFDC secreted protein; follicular dendritic cell secreted peptide; MGC71894 FDCSP C4orf7, FDC-SP follicular dendritic cell secreted protein follicular dendritic cell secreted peptide|FDC secreted protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on FDCSP, check out the FDCSP Infographic

FDCSP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FDCSP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A13093-1 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

C4orf7 contributes to ovarian cancer metastasis by promoting cancer cell migration and invasion

Development and characterization of a novel method for the analysis of gene expression patterns in lymphatic endothelial cells derived from primary breast tissues

Have you used Anti-FDCSP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-FDCSP Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-FDCSP Antibody Picoband™

Question

Will anti-FDCSP antibody A13093-1 work for IHC with minor salivary gland?

Verified Customer

Verified customer

Asked: 2020-02-03

Answer

According to the expression profile of minor salivary gland, FDCSP is highly expressed in minor salivary gland. So, it is likely that anti-FDCSP antibody A13093-1 will work for IHC with minor salivary gland.

Boster Scientific Support

Answered: 2020-02-03

Question

We are currently using anti-FDCSP antibody A13093-1 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-01-22

Answer

The anti-FDCSP antibody (A13093-1) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-01-22

Question

Is this A13093-1 anti-FDCSP antibody reactive to the isotypes of FDCSP?

Verified Customer

Verified customer

Asked: 2018-12-04

Answer

The immunogen of A13093-1 anti-FDCSP antibody is A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-12-04

Question

I was wanting to use to test anti-FDCSP antibody A13093-1 on human minor salivary gland for research purposes, then I may be interested in using anti-FDCSP antibody A13093-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-11-02

Answer

The products we sell, including anti-FDCSP antibody A13093-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-11-02

Question

My question regarding product A13093-1, anti-FDCSP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-09-24

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A13093-1 anti-FDCSP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-24

Order DetailsPrice
A13093-1

100μg

$370
A13093-1-10ug

10μg sample (liquid)

$99
A13093-1-Biotin

100 μg Biotin conjugated

$570
A13093-1-Cy3

100 μg Cy3 conjugated

$570
A13093-1-Dylight488

100 μg Dylight488 conjugated

$570
A13093-1-Dylight550

100 μg Dylight550 conjugated

$570
A13093-1-Dylight594

100 μg Dylight594 conjugated

$570
A13093-1-FITC

100 μg FITC conjugated

$570
A13093-1-HRP

100 μg HRP conjugated

$570
A13093-1-APC

100 μg APC conjugated

$670
A13093-1-PE

100 μg PE conjugated

$670
A13093-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
A13093-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.