Anti-GFI1 Antibody Picoband™

Boster Bio Anti-GFI1 Antibody Picoband™ catalog # A00888-1. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00888-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC

Product Name

Anti-GFI1 Antibody Picoband™

See all GFI-1 products

SKU/Catalog Number

A00888-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GFI1 Antibody Picoband™ catalog # A00888-1. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GFI1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00888-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00888-1 is reactive to GFI1 in Human, Mouse, Rat

Applications

A00888-1 is guaranteed for IHC Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For GFI1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q99684

Gene ID

2672

Gene Name

GFI1

Full Name

Zinc finger protein Gfi-1

Weight

45.297kDa

Alternative Names

GFI1; GFI-1; growth factor independence-1; growth factor independent 1 transcription repressor; growth factor independent 1; Growth factor independent protein 1; Pal-1; SCN2; Zinc finger protein 163; zinc finger protein Gfi-1; ZNF163; ZNF163FLJ94509 GFI1 GFI-1A, SCN2, ZNF163, GFI1 growth factor independent 1 transcriptional repressor zinc finger protein Gfi-1|growth factor independence-1|growth factor independent 1 transcription repressor|growth factor independent protein 1|zinc finger protein 163

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on GFI1, check out the GFI1 Infographic

GFI1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for GFI1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00888-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GFI1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-GFI1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-GFI1 Antibody Picoband™

Question

We are currently using anti-GFI1 antibody A00888-1 for rat tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-31

Answer

The anti-GFI1 antibody (A00888-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-31

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00888-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.