Anti-MATH1/HATH1/ATOH1 Antibody Picoband™

MATH1 antibody

Boster Bio Anti-MATH1/HATH1/ATOH1 Antibody Picoband™ catalog # A02207-1. Tested in WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: A02207-1
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Product Name

Anti-MATH1/HATH1/ATOH1 Antibody Picoband™

View all MATH1 Antibodies

SKU/Catalog Number

A02207-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MATH1/HATH1/ATOH1 Antibody Picoband™ catalog # A02207-1. Tested in WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MATH1/HATH1/ATOH1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02207-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1, different from the related mouse sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02207-1 is reactive to ATOH1 in Human, Rat

Applications

A02207-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

38 kDa

Calculated molecular weight

38.16kDa

Background of MATH1

Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ATOH1 (Source: Uniprot.org, NCBI)

Gene Name

ATOH1

Full Name

Protein atonal homolog 1

Weight

38.16kDa

Alternative Names

ATH1protein atonal homolog 1; atonal homolog 1 (Drosophila); BHLHA14; bHLHa14Math1; Class A basic helix-loop-helix protein 14; HATH1; Helix-loop-helix protein hATH-1; MATH-1 ATOH1 ATH1, HATH1, MATH-1, bHLHa14 atonal bHLH transcription factor 1 protein atonal homolog 1|atonal homolog 1|atonal homolog bHLH transcription factor 1|class A basic helix-loop-helix protein 14|helix-loop-helix protein hATH-1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ATOH1, check out the ATOH1 Infographic

ATOH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATOH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A02207-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-MATH1/HATH1/ATOH1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-MATH1/HATH1/ATOH1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-MATH1/HATH1/ATOH1 Antibody Picoband™

Question

Is this A02207-1 anti-MATH1/HATH1/ATOH1 antibody reactive to the isotypes of ATOH1?

S. Roberts

Verified customer

Asked: 2018-12-18

Answer

The immunogen of A02207-1 anti-MATH1/HATH1/ATOH1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-12-18

Question

See attached the WB image, lot number and protocol we used for mucosa of transverse colon using anti-MATH1/HATH1/ATOH1 antibody A02207-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-12-03

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-12-03

Question

We are currently using anti-MATH1/HATH1/ATOH1 antibody A02207-1 for rat tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on feline tissues as well?

J. Zhao

Verified customer

Asked: 2013-11-04

Answer

The anti-MATH1/HATH1/ATOH1 antibody (A02207-1) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-11-04

Question

I was wanting to use your anti-MATH1/HATH1/ATOH1 antibody for WB for rat mucosa of transverse colon on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat mucosa of transverse colon identification?

B. Lewis

Verified customer

Asked: 2013-01-02

Answer

You can see on the product datasheet, A02207-1 anti-MATH1/HATH1/ATOH1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat mucosa of transverse colon in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-01-02

Order DetailsPrice
A02207-1

100μg

$370
A02207-1-10ug

10μg sample (liquid)

$99
A02207-1-Biotin

100 μg Biotin conjugated

$570
A02207-1-Cy3

100 μg Cy3 conjugated

$570
A02207-1-Dylight488

100 μg Dylight488 conjugated

$570
A02207-1-Dylight550

100 μg Dylight550 conjugated

$570
A02207-1-Dylight594

100 μg Dylight594 conjugated

$570
A02207-1-FITC

100 μg FITC conjugated

$570
A02207-1-HRP

100 μg HRP conjugated

$570
A02207-1-APC

100 μg APC conjugated

$670
A02207-1-PE

100 μg PE conjugated

$670
A02207-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02207-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.