Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™

Isocitrate Dehydrogenase 1/IDH1 antibody

Boster Bio Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™ catalog # PB9601. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PB9601
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, IHC-F, ICC, WB

Product Name

Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™

View all Isocitrate Dehydrogenase 1/IDH1 Antibodies

SKU/Catalog Number

PB9601

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™ catalog # PB9601. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9601)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1, different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9601 is reactive to IDH1 in Human, Mouse, Rat

Applications

PB9601 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee

Observed Molecular Weight

47 kDa

Calculated molecular weight

46.659kDa

Background of Isocitrate Dehydrogenase 1/IDH1

Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD (+) as the electron acceptor and the other NADP (+). Five isocitrate dehydrogenases have been reported: three NAD (+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP (+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP (+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP (+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For IDH1 (Source: Uniprot.org, NCBI)

Gene Name

IDH1

Full Name

Isocitrate dehydrogenase [NADP] cytoplasmic

Weight

46.659kDa

Superfamily

isocitrate and isopropylmalate dehydrogenases family

Alternative Names

Cytosolic NADP-isocitrate dehydrogenase; EC 1.1.1.42; IDCD; IDH; IDH1; IDP; IDPC; isocitrate dehydrogenase [NADP] cytoplasmic; isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate Dehydrogenase 1; NADP(+)-specific ICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; Oxalosuccinate decarboxylase; PICD IDH1 HEL-216, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD isocitrate dehydrogenase (NADP(+)) 1 isocitrate dehydrogenase [NADP] cytoplasmic|NADP(+)-specific ICDH|NADP-dependent isocitrate dehydrogenase, cytosolic|NADP-dependent isocitrate dehydrogenase, peroxisomal|epididymis luminal protein 216|epididymis secretory protein Li 26|epididymis secretory sperm binding protein|isocitrate dehydrogenase (NADP(+)) 1, cytosolic|isocitrate dehydrogenase 1 (NADP+), soluble|oxalosuccinate decarboxylase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on IDH1, check out the IDH1 Infographic

IDH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IDH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9601 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPAR? pathway in hepatocellular carcinoma

Have you used Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™

Question

We are currently using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 for rat tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-29

Answer

The anti-Isocitrate dehydrogenase/IDH1 antibody (PB9601) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-29

Question

See below the WB image, lot number and protocol we used for metanephros using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-10-09

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-09

Question

Is this PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody reactive to the isotypes of IDH1?

Verified Customer

Verified customer

Asked: 2019-09-27

Answer

The immunogen of PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-27

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for metanephros using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-06-20

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-20

Question

Will PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-02-22

Answer

As indicated on the product datasheet, PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-02-22

Question

My team were content with the WB result of your anti-Isocitrate dehydrogenase/IDH1 antibody. However we have observed positive staining in cajal-retzius cell fetal brain cortex cytoplasm using this antibody. Is that expected? Could you tell me where is IDH1 supposed to be expressed?

D. Parker

Verified customer

Asked: 2019-01-18

Answer

According to literature, cajal-retzius cell fetal brain cortex does express IDH1. Generally IDH1 expresses in cytoplasm, cytosol. Regarding which tissues have IDH1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 19608861
Endometrium, Pubmed ID: 17974005
Kidney, Pubmed ID: 11230166
Liver, Pubmed ID: 24275569
Lung, and Placenta, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-01-18

Question

We want to test anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 on human metanephros for research purposes, then I may be interested in using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-01-14

Answer

The products we sell, including anti-Isocitrate dehydrogenase/IDH1 antibody PB9601, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-01-14

Question

I see that the anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 works with WB, what is the protocol used to produce the result images on the product page?

W. Evans

Verified customer

Asked: 2018-10-10

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-10-10

Question

We have observed staining in human kidney. What should we do? Is anti-Isocitrate dehydrogenase/IDH1 antibody supposed to stain kidney positively?

Verified Customer

Verified customer

Asked: 2018-07-13

Answer

From literature kidney does express IDH1. From Uniprot.org, IDH1 is expressed in metanephros, kidney, endometrium, lung placenta, brain, cajal-retzius cell fetal brain cortex, liver, among other tissues. Regarding which tissues have IDH1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 19608861
Endometrium, Pubmed ID: 17974005
Kidney, Pubmed ID: 11230166
Liver, Pubmed ID: 24275569
Lung, and Placenta, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2018-07-13

Question

Do you have a BSA free version of anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 available?

Verified Customer

Verified customer

Asked: 2018-06-22

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-06-22

Question

Is a blocking peptide available for product anti-Isocitrate dehydrogenase/IDH1 antibody (PB9601)?

Verified Customer

Verified customer

Asked: 2017-09-14

Answer

We do provide the blocking peptide for product anti-Isocitrate dehydrogenase/IDH1 antibody (PB9601). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-09-14

Question

Would anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 work for WB with metanephros?

Verified Customer

Verified customer

Asked: 2017-05-25

Answer

According to the expression profile of metanephros, IDH1 is highly expressed in metanephros. So, it is likely that anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 will work for WB with metanephros.

Boster Scientific Support

Answered: 2017-05-25

Question

My lab would like using your anti-Isocitrate dehydrogenase/IDH1 antibody for protein targeting to peroxisome studies. Has this antibody been tested with western blotting on rat lung tissue? We would like to see some validation images before ordering.

G. Li

Verified customer

Asked: 2017-04-04

Answer

We appreciate your inquiry. This PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody is validated on rat lung tissue, tissue lysate, kidney tissue, brain tissue, hela whole cell lysate, smmc whole cell lysate, a549 whole cell lysate, nih3t3 whole cell lysate, mouse testis tissue, intestinal cancer tissue, small intestine tissue, hepg2 cells. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-04-04

Question

We bought anti-Isocitrate dehydrogenase/IDH1 antibody for IHC-P on liver a few months ago. I am using human, and We are going to use the antibody for IF next. you antibody examining liver as well as kidney in our next experiment. Could give a recommendation on which antibody would work the best for IF?

E. Jackson

Verified customer

Asked: 2016-04-04

Answer

I have checked the website and datasheets of our anti-Isocitrate dehydrogenase/IDH1 antibody and it appears that PB9601 has been tested on human in both IHC-P and IF. Thus PB9601 should work for your application. Our Boster satisfaction guarantee will cover this product for IF in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IF detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2016-04-04

Question

My question regarding product PB9601, anti-Isocitrate dehydrogenase/IDH1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

W. Brown

Verified customer

Asked: 2015-06-02

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-06-02

Question

I was wanting to use your anti-Isocitrate dehydrogenase/IDH1 antibody for WB for human metanephros on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human metanephros identification?

B. Parker

Verified customer

Asked: 2015-03-03

Answer

As indicated on the product datasheet, PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human metanephros in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-03-03

Order DetailsPrice
PB9601

100μg

$370
PB9601-10ug

10μg sample (liquid)

$99
PB9601-Biotin

100 μg Biotin conjugated

$570
PB9601-Cy3

100 μg Cy3 conjugated

$570
PB9601-Dylight488

100 μg Dylight488 conjugated

$570
PB9601-Dylight550

100 μg Dylight550 conjugated

$570
PB9601-Dylight594

100 μg Dylight594 conjugated

$570
PB9601-FITC

100 μg FITC conjugated

$570
PB9601-HRP

100 μg HRP conjugated

$570
PB9601-APC

100 μg APC conjugated

$670
PB9601-PE

100 μg PE conjugated

$670
PB9601-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB9601
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.