Product Info Summary
SKU: | PB9601 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, IHC-F, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™
View all Isocitrate Dehydrogenase 1/IDH1 Antibodies
SKU/Catalog Number
PB9601
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™ catalog # PB9601. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9601)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9601 is reactive to IDH1 in Human, Mouse, Rat
Applications
PB9601 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee
Observed Molecular Weight
47 kDa
Calculated molecular weight
46.659kDa
Background of Isocitrate Dehydrogenase 1/IDH1
Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD (+) as the electron acceptor and the other NADP (+). Five isocitrate dehydrogenases have been reported: three NAD (+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP (+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP (+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP (+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of IDH1 using anti-IDH1 antibody (PB9601).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: Rat Lung Tissue Lysate,
Lane 2: Rat Kidney Tissue Lysate,
Lane 3: Rat Brain Tissue Lysate,
Lane 4: HELA Whole Cell Lysate,
Lane 5: SMMC Whole Cell Lysate,
Lane 6: A549 Whole Cell Lysate,
Lane 7: NIH3T3 Whole Cell Lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IDH1 antigen affinity purified polyclonal antibody (Catalog # PB9601) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IDH1 at approximately 47KD. The expected band size for IDH1 is at 47KD.
Click image to see more details
Figure 2. IHC analysis of IDH1 using anti-IDH1 antibody (PB9601).
IDH1 was detected in paraffin-embedded section of Mouse Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-IDH1 Antibody (PB9601) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of IDH1 using anti-IDH1 antibody (PB9601).
IDH1 was detected in paraffin-embedded section of Rat Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-IDH1 Antibody (PB9601) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of IDH1 using anti-IDH1 antibody (PB9601).
IDH1 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-IDH1 Antibody (PB9601) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of IDH1 using anti-IDH1 antibody (PB9601).
IDH1 was detected in frozen section of rat small intestine tissue. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-IDH1 Antibody (PB9601) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of IDH1 using anti-IDH1 antibody (PB9601).
IDH1 was detected in immunocytochemical section of A549 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 1μg/ml rabbit anti-IDH1 Antibody (PB9601) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. Flow Cytometry analysis of HepG2 cells using anti-IDH1 antibody (PB9601).
Overlay histogram showing HepG2 cells stained with PB9601 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IDH1 Antibody (PB9601,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For IDH1 (Source: Uniprot.org, NCBI)
Gene Name
IDH1
Full Name
Isocitrate dehydrogenase [NADP] cytoplasmic
Weight
46.659kDa
Superfamily
isocitrate and isopropylmalate dehydrogenases family
Alternative Names
Cytosolic NADP-isocitrate dehydrogenase; EC 1.1.1.42; IDCD; IDH; IDH1; IDP; IDPC; isocitrate dehydrogenase [NADP] cytoplasmic; isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate Dehydrogenase 1; NADP(+)-specific ICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; Oxalosuccinate decarboxylase; PICD IDH1 HEL-216, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD isocitrate dehydrogenase (NADP(+)) 1 isocitrate dehydrogenase [NADP] cytoplasmic|NADP(+)-specific ICDH|NADP-dependent isocitrate dehydrogenase, cytosolic|NADP-dependent isocitrate dehydrogenase, peroxisomal|epididymis luminal protein 216|epididymis secretory protein Li 26|epididymis secretory sperm binding protein|isocitrate dehydrogenase (NADP(+)) 1, cytosolic|isocitrate dehydrogenase 1 (NADP+), soluble|oxalosuccinate decarboxylase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on IDH1, check out the IDH1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IDH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™ (PB9601)
Hello CJ!
PB9601 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPAR? pathway in hepatocellular carcinoma
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Isocitrate dehydrogenase/IDH1 Antibody Picoband™
Question
We are currently using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 for rat tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-10-29
Answer
The anti-Isocitrate dehydrogenase/IDH1 antibody (PB9601) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-10-29
Question
See below the WB image, lot number and protocol we used for metanephros using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-10-09
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-09
Question
Is this PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody reactive to the isotypes of IDH1?
Verified Customer
Verified customer
Asked: 2019-09-27
Answer
The immunogen of PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-09-27
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for metanephros using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-06-20
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-20
Question
Will PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-02-22
Answer
As indicated on the product datasheet, PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-02-22
Question
My team were content with the WB result of your anti-Isocitrate dehydrogenase/IDH1 antibody. However we have observed positive staining in cajal-retzius cell fetal brain cortex cytoplasm using this antibody. Is that expected? Could you tell me where is IDH1 supposed to be expressed?
D. Parker
Verified customer
Asked: 2019-01-18
Answer
According to literature, cajal-retzius cell fetal brain cortex does express IDH1. Generally IDH1 expresses in cytoplasm, cytosol. Regarding which tissues have IDH1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 19608861
Endometrium, Pubmed ID: 17974005
Kidney, Pubmed ID: 11230166
Liver, Pubmed ID: 24275569
Lung, and Placenta, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-01-18
Question
We want to test anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 on human metanephros for research purposes, then I may be interested in using anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-01-14
Answer
The products we sell, including anti-Isocitrate dehydrogenase/IDH1 antibody PB9601, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-01-14
Question
I see that the anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 works with WB, what is the protocol used to produce the result images on the product page?
W. Evans
Verified customer
Asked: 2018-10-10
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-10-10
Question
We have observed staining in human kidney. What should we do? Is anti-Isocitrate dehydrogenase/IDH1 antibody supposed to stain kidney positively?
Verified Customer
Verified customer
Asked: 2018-07-13
Answer
From literature kidney does express IDH1. From Uniprot.org, IDH1 is expressed in metanephros, kidney, endometrium, lung placenta, brain, cajal-retzius cell fetal brain cortex, liver, among other tissues. Regarding which tissues have IDH1 expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 19608861
Endometrium, Pubmed ID: 17974005
Kidney, Pubmed ID: 11230166
Liver, Pubmed ID: 24275569
Lung, and Placenta, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2018-07-13
Question
Do you have a BSA free version of anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 available?
Verified Customer
Verified customer
Asked: 2018-06-22
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-06-22
Question
Is a blocking peptide available for product anti-Isocitrate dehydrogenase/IDH1 antibody (PB9601)?
Verified Customer
Verified customer
Asked: 2017-09-14
Answer
We do provide the blocking peptide for product anti-Isocitrate dehydrogenase/IDH1 antibody (PB9601). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-09-14
Question
Would anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 work for WB with metanephros?
Verified Customer
Verified customer
Asked: 2017-05-25
Answer
According to the expression profile of metanephros, IDH1 is highly expressed in metanephros. So, it is likely that anti-Isocitrate dehydrogenase/IDH1 antibody PB9601 will work for WB with metanephros.
Boster Scientific Support
Answered: 2017-05-25
Question
My lab would like using your anti-Isocitrate dehydrogenase/IDH1 antibody for protein targeting to peroxisome studies. Has this antibody been tested with western blotting on rat lung tissue? We would like to see some validation images before ordering.
G. Li
Verified customer
Asked: 2017-04-04
Answer
We appreciate your inquiry. This PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody is validated on rat lung tissue, tissue lysate, kidney tissue, brain tissue, hela whole cell lysate, smmc whole cell lysate, a549 whole cell lysate, nih3t3 whole cell lysate, mouse testis tissue, intestinal cancer tissue, small intestine tissue, hepg2 cells. It is guaranteed to work for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-04-04
Question
We bought anti-Isocitrate dehydrogenase/IDH1 antibody for IHC-P on liver a few months ago. I am using human, and We are going to use the antibody for IF next. you antibody examining liver as well as kidney in our next experiment. Could give a recommendation on which antibody would work the best for IF?
E. Jackson
Verified customer
Asked: 2016-04-04
Answer
I have checked the website and datasheets of our anti-Isocitrate dehydrogenase/IDH1 antibody and it appears that PB9601 has been tested on human in both IHC-P and IF. Thus PB9601 should work for your application. Our Boster satisfaction guarantee will cover this product for IF in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IF detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2016-04-04
Question
My question regarding product PB9601, anti-Isocitrate dehydrogenase/IDH1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
W. Brown
Verified customer
Asked: 2015-06-02
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2015-06-02
Question
I was wanting to use your anti-Isocitrate dehydrogenase/IDH1 antibody for WB for human metanephros on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human metanephros identification?
B. Parker
Verified customer
Asked: 2015-03-03
Answer
As indicated on the product datasheet, PB9601 anti-Isocitrate dehydrogenase/IDH1 antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human metanephros in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-03-03