Click image to see more details
Product Info Summary
| SKU: | PB9807 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Kv1.4/KCNA4 Antibody Picoband®
SKU/Catalog Number
PB9807
PB0849 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Kv1.4/KCNA4 Antibody Picoband® catalog # PB9807. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Kv1.4/KCNA4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9807)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4, different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9807 is reactive to KCNA4 in Human
Observed Molecular Weight
73 kDa
Calculated molecular weight
73.3 kDa
Background of KCNA4
Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9807 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: HELA Whole Cell, COLO320 Whole Cell, HT1080 Whole Cell, PANC Whole Cell
IHC: human lung cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of Kv1.4 using anti-Kv1.4 antibody (PB9807).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40 ug of sample under reducing conditions.
Lane 1: HELA Whole Cell Lysate,
Lane 2: COLO320 Whole Cell Lysate,
Lane 3: HT1080 Whole Cell Lysate,
Lane 4: PANC Whole Cell Lysate.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Kv1.4 antigen affinity purified polyclonal antibody (Catalog # PB9807) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Kv1.4 at approximately 73 kDa. The expected band size for Kv1.4 is at 73 kDa.
Click image to see more details
IHC analysis of Kv1.4 using anti-Kv1.4 antibody (PB9807).
Kv1.4 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Kv1.4 Antibody (PB9807) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Specific Publications For Anti-Kv1.4/KCNA4 Antibody Picoband® (PB9807)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Kv1.4/KCNA4 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Kv1.4/KCNA4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Kv1.4/KCNA4 Antibody Picoband®
Question
I was wanting to use your anti-Kv1.4/KCNA4 antibody for IHC for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2018-07-02
Answer
It shows on the product datasheet, PB9807 anti-Kv1.4/KCNA4 antibody has been validated for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-07-02
Question
Is this PB9807 anti-Kv1.4/KCNA4 antibody reactive to the isotypes of KCNA4?
C. Yang
Verified customer
Asked: 2015-12-23
Answer
The immunogen of PB9807 anti-Kv1.4/KCNA4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2015-12-23
Question
We are currently using anti-Kv1.4/KCNA4 antibody PB9807 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on monkey tissues as well?
L. Carter
Verified customer
Asked: 2014-11-06
Answer
The anti-Kv1.4/KCNA4 antibody (PB9807) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-11-06
Question
I would like to test anti-Kv1.4/KCNA4 antibody PB9807 on human brain for research purposes, then I may be interested in using anti-Kv1.4/KCNA4 antibody PB9807 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
N. Edwards
Verified customer
Asked: 2014-04-02
Answer
The products we sell, including anti-Kv1.4/KCNA4 antibody PB9807, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2014-04-02
