Product Info Summary
| SKU: | A01262-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Melanoma gp100/PMEL Antibody Picoband®
SKU/Catalog Number
A01262-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Melanoma gp100/PMEL Antibody Picoband® catalog # A01262-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Melanoma gp100/PMEL Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01262-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Melanoma gp100/PMEL, which shares 71.4% and 65.7% amino acid (aa) sequence identity with mouse and rat Melanoma gp100/PMEL, respectively.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01262-1 is reactive to PMEL in Human, Mouse, Rat
Observed Molecular Weight
80 kDa
Calculated molecular weight
70.3 kDa
Background of PMEL
This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01262-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human A2058 whole cell, rat testis tissue, rat C6 whole cell, mouse testis tissue
IHC: human melanoma tissue, human melanoma tissue
IF: human melanoma tissue
FCM: U20S cell
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of SILV/PMEL using anti-SILV/PMEL antibody (A01262-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human A2058 whole cell lysates,
Lane 2: rat testis tissue lysates,
Lane 3: rat C6 whole cell lysates,
Lane 4: mouse testis tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SILV/PMEL antigen affinity purified polyclonal antibody (Catalog # A01262-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SILV/PMEL at approximately 80 kDa. The expected band size for SILV/PMEL is at 70 kDa.
Click image to see more details
IHC analysis of SILV/PMEL using anti-SILV/PMEL antibody (A01262-1).
SILV/PMEL was detected in a paraffin-embedded section of human melanoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-SILV/PMEL Antibody (A01262-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of SILV/PMEL using anti-SILV/PMEL antibody (A01262-1).
SILV/PMEL was detected in a paraffin-embedded section of human melanoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-SILV/PMEL Antibody (A01262-1) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IF analysis of SILV/PMEL using anti-SILV/PMEL antibody (A01262-1).
SILV/PMEL was detected in a paraffin-embedded section of human melanoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 μg/mL rabbit anti-SILV/PMEL Antibody (A01262-1) overnight at 4°C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Flow Cytometry analysis of U20S cells using anti-SILV/PMEL antibody (A01262-1).
Overlay histogram showing U20S cells stained with A01262-1 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SILV/PMEL Antibody (A01262-1, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Specific Publications For Anti-Melanoma gp100/PMEL Antibody Picoband® (A01262-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Melanoma gp100/PMEL Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Melanoma gp100/PMEL Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Melanoma gp100/PMEL Antibody Picoband®
Question
Would anti-Melanoma gp100/PMEL antibody A01262-1 work for WB with melanoma?
Verified Customer
Verified customer
Asked: 2020-03-18
Answer
According to the expression profile of melanoma, PMEL is highly expressed in melanoma. So, it is likely that anti-Melanoma gp100/PMEL antibody A01262-1 will work for WB with melanoma.
Boster Scientific Support
Answered: 2020-03-18
Question
Do you have a BSA free version of anti-Melanoma gp100/PMEL antibody A01262-1 available?
Verified Customer
Verified customer
Asked: 2020-02-19
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Melanoma gp100/PMEL antibody A01262-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-19
Question
Does A01262-1 anti-Melanoma gp100/PMEL antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-02-18
Answer
You can see on the product datasheet, A01262-1 anti-Melanoma gp100/PMEL antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-02-18
Question
We have seen staining in human pigmented layer of retina. Any tips? Is anti-Melanoma gp100/PMEL antibody supposed to stain pigmented layer of retina positively?
Verified Customer
Verified customer
Asked: 2020-01-31
Answer
Based on literature pigmented layer of retina does express PMEL. Based on Uniprot.org, PMEL is expressed in pigmented layer of retina, placenta spleen, placenta, melanoma, among other tissues. Regarding which tissues have PMEL expression, here are a few articles citing expression in various tissues:
Melanoma, Pubmed ID: 12643545, 17081065
Placenta, Pubmed ID: 15489334
Placenta, and Spleen, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-01-31
Question
We are currently using anti-Melanoma gp100/PMEL antibody A01262-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2019-12-26
Answer
The anti-Melanoma gp100/PMEL antibody (A01262-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-12-26
Question
Is a blocking peptide available for product anti-Melanoma gp100/PMEL antibody (A01262-1)?
Verified Customer
Verified customer
Asked: 2019-12-18
Answer
We do provide the blocking peptide for product anti-Melanoma gp100/PMEL antibody (A01262-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2019-12-18
Question
Can you help my question with product A01262-1, anti-Melanoma gp100/PMEL antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-12-11
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01262-1 anti-Melanoma gp100/PMEL antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-12-11
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for melanoma using anti-Melanoma gp100/PMEL antibody A01262-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-06-27
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-27
Question
I see that the anti-Melanoma gp100/PMEL antibody A01262-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-06-17
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-06-17
Question
We want to test anti-Melanoma gp100/PMEL antibody A01262-1 on rat melanoma for research purposes, then I may be interested in using anti-Melanoma gp100/PMEL antibody A01262-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-17
Answer
The products we sell, including anti-Melanoma gp100/PMEL antibody A01262-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-17
Question
We need using your anti-Melanoma gp100/PMEL antibody for melanin biosynthetic process studies. Has this antibody been tested with western blotting on rat heart tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-17
Answer
We appreciate your inquiry. This A01262-1 anti-Melanoma gp100/PMEL antibody is tested on rat heart tissue, tissue lysate, mouse heart tissue. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-17
Question
I was wanting to use your anti-Melanoma gp100/PMEL antibody for WB for rat melanoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat melanoma identification?
A. Parker
Verified customer
Asked: 2017-01-09
Answer
As indicated on the product datasheet, A01262-1 anti-Melanoma gp100/PMEL antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat melanoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-01-09
Question
Please see the WB image, lot number and protocol we used for melanoma using anti-Melanoma gp100/PMEL antibody A01262-1. Please let me know if you require anything else.
P. Carter
Verified customer
Asked: 2015-12-23
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-12-23
Question
Is this A01262-1 anti-Melanoma gp100/PMEL antibody reactive to the isotypes of PMEL?
S. Parker
Verified customer
Asked: 2014-09-26
Answer
The immunogen of A01262-1 anti-Melanoma gp100/PMEL antibody is A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-09-26
Question
We were well pleased with the WB result of your anti-Melanoma gp100/PMEL antibody. However we have been able to see positive staining in placenta spleen endoplasmic reticulum membrane using this antibody. Is that expected? Could you tell me where is PMEL supposed to be expressed?
S. Collins
Verified customer
Asked: 2013-03-06
Answer
From literature, placenta spleen does express PMEL. Generally PMEL expresses in endoplasmic reticulum membrane. Regarding which tissues have PMEL expression, here are a few articles citing expression in various tissues:
Melanoma, Pubmed ID: 12643545, 17081065
Placenta, Pubmed ID: 15489334
Placenta, and Spleen, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2013-03-06


