Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

TH antibody

Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband® catalog # PB9449. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 30 publication(s). Independently reviewed in 1 review(s).

Product Info Summary

SKU: PB9449
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

View all TH Antibodies

SKU/Catalog Number

PB9449

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband® catalog # PB9449. Tested in IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Tyrosine Hydroxylase/TH Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9449)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9449 is reactive to TH in Human, Mouse, Rat

Observed Molecular Weight

59 kDa

Calculated molecular weight

58.6 kDa

Background of TH

TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9449 is guaranteed for IF, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat
Immunofluorescence, 5μg/ml, Mouse, Rat

Positive Control

WB: rat brain tissue, mouse brain tissue
IHC: human brain tissue, mouse brain tissue, rat brain tissue
IF: mouse brian tissue, rat brian tissue

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Tyrosine Hydroxylase/TH Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

1 Reviews For Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

IHC using Tyrosine Hydroxylase/TH Antibody Picoband® (P00683) showed clear staining with no background, revealing markedly reduced TH expression in the medulla of Alzheimer’s mouse brain compared to normal mouse brain.

Excellent

SKU PB9449
Application Immunohistochemistry
Sample Normal mouse brain and Alzheimer’s model mouse brain tissue
Sample Processing Description Paraffin-embedded normal mouse brain and Alzheimer’s model mouse brain.
Other Reagents Goat serum, DAB
Primary Antibody Tyrosine Hydroxylase/TH Antibody Picoband®
Primary Incubation 1:500, overnight at 4 ℃
Secondary Antibody Two-step IHC kit
Secondary Incubation 37 minutes in 37 ℃
Detection Imaging system:Leica DM2500
Results Summary TH is a marker of catecholaminergic neurons, specifically labeling dopaminergic, noradrenergic, and adrenergic neurons. IHC results showed that TH expression in the medulla was markedly lower in Alzheimer’s mouse compared to normal mouse.

Verified customer

Submitted

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Tyrosine Hydroxylase/TH Antibody Picoband®

Question

Is there a BSA free version of anti-Tyrosine Hydroxylase/TH antibody PB9449 available?

Verified Customer

Verified customer

Asked: 2020-04-03

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Tyrosine Hydroxylase/TH antibody PB9449 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-03

Question

We are currently using anti-Tyrosine Hydroxylase/TH antibody PB9449 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

The anti-Tyrosine Hydroxylase/TH antibody (PB9449) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-28

Question

We want using your anti-Tyrosine Hydroxylase/TH antibody for heart development studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-11-11

Answer

I appreciate your inquiry. This PB9449 anti-Tyrosine Hydroxylase/TH antibody is validated on rat brain tissue, tissue lysate, mouse brain. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-11-11

Question

Is PB9449 suitable for immunostaining of mouse long bone nerve fibers?

Verified customer

Asked: 2019-10-06

Answer

Yes, Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ (PB9449) is suitable for the immunostaining of mouse long bone nerve fibers.

Boster Scientific Support

Answered: 2019-10-09

Question

I was wanting to use your anti-Tyrosine Hydroxylase/TH antibody for WB for rat substantia nigra on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat substantia nigra identification?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody has been tested for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat substantia nigra in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-05

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-07-25

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-25

Question

Is a blocking peptide available for product anti-Tyrosine Hydroxylase/TH antibody (PB9449)?

Verified Customer

Verified customer

Asked: 2019-06-24

Answer

We do provide the blocking peptide for product anti-Tyrosine Hydroxylase/TH antibody (PB9449). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-06-24

Question

Does PB9449 anti-Tyrosine Hydroxylase/TH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

S. Moore

Verified customer

Asked: 2019-03-26

Answer

It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-03-26

Question

Does anti-Tyrosine Hydroxylase/TH antibody PB9449 work for WB with substantia nigra?

Verified Customer

Verified customer

Asked: 2019-02-14

Answer

According to the expression profile of substantia nigra, TH is highly expressed in substantia nigra. So, it is likely that anti-Tyrosine Hydroxylase/TH antibody PB9449 will work for WB with substantia nigra.

Boster Scientific Support

Answered: 2019-02-14

Question

I have a question about product PB9449, anti-Tyrosine Hydroxylase/TH antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

H. Baker

Verified customer

Asked: 2018-09-26

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9449 anti-Tyrosine Hydroxylase/TH antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-26

Question

I see that the anti-Tyrosine Hydroxylase/TH antibody PB9449 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-09-07

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2018-09-07

Question

See below the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-06-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-28

Question

Is this PB9449 anti-Tyrosine Hydroxylase/TH antibody reactive to the isotypes of TH?

Verified Customer

Verified customer

Asked: 2018-05-16

Answer

The immunogen of PB9449 anti-Tyrosine Hydroxylase/TH antibody is A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-05-16

Question

you antibody to test anti-Tyrosine Hydroxylase/TH antibody PB9449 on rat substantia nigra for research purposes, then I may be interested in using anti-Tyrosine Hydroxylase/TH antibody PB9449 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

T. Baker

Verified customer

Asked: 2015-10-27

Answer

The products we sell, including anti-Tyrosine Hydroxylase/TH antibody PB9449, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-10-27

Order DetailsPrice
PB9449

100μg

$370
PB9449-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9449-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9449-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9449-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9449-APC

100 μg APC conjugated (liquid)

$820
PB9449-FITC

100 μg FITC conjugated (liquid)

$570
PB9449-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9449-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9449-HRP

100 μg HRP conjugated (liquid)

$570
PB9449-PE

100 μg PE conjugated (liquid)

$820
PB9449-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9449
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 30, 2026