Anti-Tyrosine Hydroxylase/TH Antibody Picoband™

Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ catalog # PB9449. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 13 publication(s).

Product Info Summary

SKU: PB9449
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-Tyrosine Hydroxylase/TH Antibody Picoband™

See all Tyrosine Hydroxylase products

SKU/Catalog Number

PB9449

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ catalog # PB9449. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9449)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9449 is reactive to TH in Human, Mouse, Rat

Applications

PB9449 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For TH (Source: Uniprot.Org, NCBI)

Uniprot ID

P07101

Gene ID

7054

Gene Name

TH

Full Name

Tyrosine 3-monooxygenase

Weight

58.6kDa

Superfamily

biopterin-dependent aromatic amino acid hydroxylase family

Alternative Names

TH; DYT14; DYT5b; EC 1.14.16; EC 1.14.16.2; TH mouse; TH; TYH dystonia 14; TYH; Tyrosine 3-hydroxylase; tyrosine 3-monooxygenase; Tyrosine Hydroxylase immunohistochemistry; Tyrosine Hydroxylase mouse; Tyrosine Hydroxylase TH DYT14, DYT5b, TYH tyrosine hydroxylase tyrosine 3-monooxygenase|dystonia 14|tyrosine 3-hydroxylase

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TH, check out the TH Infographic

TH infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TH: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB9449 has been cited in 13 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Ultra-trace graphene oxide in a water environment triggers Parkinson‘s disease-like symptoms and metabolic disturbance in zebrafish larvae
Species: Zebrafish

Liu Y,Li L,Qiu M,Tan L,Zhang M,Li J,Zhu H,Jiang S,Su X,Li A.Renal and cerebral RAS interaction contributes to diabetic kidney disease.Am J Transl Res.2019 May 15;11(5):2925-2939.PMID:31217864;PMCID:PMC6556645.
Species: Rat
PB9449 usage in article: APP:WB, SAMPLE:BRAIN TISSUE, DILUTION:1:200

NPPB prevents postoperative peritoneal adhesion formation by blocking volume-activated Cl - current. Changqing Zhou,Shanshan Li,Min Wang,Zhongmei Chen,Guoguang Peng
Species: Mouse
PB9449 usage in article: APP:IHC, SAMPLE:BRAIN TISSUE, DILUTION:1:150

Autonomic remodeling may be responsible for decreased incidence of aortic dissection in STZ-induced diabetic rats via down-regulation of matrix metalloprotease 2

Hu W, Ye Y, Wang J, Zhang W, Chen A, Guo F. Artif Cells Nanomed Biotechnol. 2013 Aug;41(4):249-54. Doi: 10.3109/10731199.2012.731412. Epub 2013 Jan 10. Bone Morphogenetic Proteins Induce Rabbit Bone Marrow-Derived Mesenchyme Stem Cells To Differen...

Li X, Jiang Yh, Jiang P, Yang Jl, Ma Df, Yang Ch. Chin J Integr Med. 2014 Jul;20(7):524-33. Doi: 10.1007/S11655-014-1861-Z. Epub 2014 Jun 28. Effect Of Guizhi Decoction ([Symbols; See Text]) On Heart Rate Variability And Regulation Of Cardiac Auto...

Su Y, Fu Y, Zhang H, Shi Z, Zhang J, Gao L. Fish Physiol Biochem. 2015 Oct;41(5):1093-104. Doi: 10.1007/S10695-015-0071-8. Epub 2015 Jun 3. Identification And Expression Of Srf Targeted By Mir-133A During Early Development Of Paralichthys Olivaceus.

Deng Y, Jiao C, Mi C, Xu B, Li Y, Wang F, Liu W, Xu Z. Mol Neurobiol. 2015 Feb;51(1):68-88. Doi: 10.1007/S12035-014-8789-3. Epub 2014 Jun 28. Melatonin Inhibits Manganese-Induced Motor Dysfunction And Neuronal Loss In Mice: Involvement Of Oxidativ...

Wu L, Zhao Q, Zhu X, Peng M, Jia C, Wu W, Zheng J, Wu Xz. Brain Pathol. 2010 Nov;20(6):1042-54. Doi: 10.1111/J.1750-3639.2010.00410.X. Epub 2010 Jun 14. A Novel Function Of Microrna Let-7D In Regulation Of Galectin-3 Expression In Attention Defici...

Wan C, Liu Nn, Liu Lm, Cai N, Chen L. Int J Ophthalmol. 2010;3(2):145-8. Doi: 10.3980/J.Issn.2222-3959.2010.02.12. Epub 2010 Jun 18. Effect Of Adenovirus-Mediated Brain Derived Neurotrophic Factor In Early Retinal Neuropathy Of Diabetes In Rats.

Zhao J, Cheng Yy, Fan W, Yang Cb, Ye Sf, Cui W, Wei W, Lao Lx, Cai J, Han Yf, Rong Jh. Cns Neurosci Ther. 2015 Jan;21(1):61-70. Doi: 10.1111/Cns.12334. Epub 2014 Oct 14. Botanical Drug Puerarin Coordinates With Nerve Growth Factor In The Regulatio...

Wu Y, Ge C, Zeng W, Zhang C. Stem Cells Dev. 2010 Feb;19(2):195-202. Doi: 10.1089/Scd.2008.0383. Induced Multilineage Differentiation Of Chicken Embryonic Germ Cells Via Embryoid Body Formation.

Huang J, Zhu C, Zhang P, Zhu Q, Liu Y, Zhu Z, Wang M, Li W, Yang G, Dong N, Liu J, Chen L, Zhang Y, Yang R, Deng L, Fan J, Wang X, Liu J, Ma B, Fu Q, Wu K. Sci Rep. 2013;3:1114. Doi: 10.1038/Srep01114. Epub 2013 Jan 23. S100+ Cells: A New Neuro-Im...

Have you used Anti-Tyrosine Hydroxylase/TH Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Tyrosine Hydroxylase/TH Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Tyrosine Hydroxylase/TH Antibody Picoband™

Question

Is there a BSA free version of anti-Tyrosine Hydroxylase/TH antibody PB9449 available?

Verified Customer

Verified customer

Asked: 2020-04-03

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Tyrosine Hydroxylase/TH antibody PB9449 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-03

Question

We are currently using anti-Tyrosine Hydroxylase/TH antibody PB9449 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

The anti-Tyrosine Hydroxylase/TH antibody (PB9449) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-28

Question

We want using your anti-Tyrosine Hydroxylase/TH antibody for heart development studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-11-11

Answer

I appreciate your inquiry. This PB9449 anti-Tyrosine Hydroxylase/TH antibody is validated on rat brain tissue, tissue lysate, mouse brain. It is guaranteed to work for IHC, WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-11-11

Question

Is PB9449 suitable for immunostaining of mouse long bone nerve fibers?

Verified customer

Asked: 2019-10-06

Answer

Yes, Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ (PB9449) is suitable for the immunostaining of mouse long bone nerve fibers.

Boster Scientific Support

Answered: 2019-10-09

Question

I was wanting to use your anti-Tyrosine Hydroxylase/TH antibody for WB for rat substantia nigra on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat substantia nigra identification?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody has been tested for IHC, WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat substantia nigra in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-05

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-07-25

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-25

Question

Is a blocking peptide available for product anti-Tyrosine Hydroxylase/TH antibody (PB9449)?

Verified Customer

Verified customer

Asked: 2019-06-24

Answer

We do provide the blocking peptide for product anti-Tyrosine Hydroxylase/TH antibody (PB9449). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-24

Question

Does PB9449 anti-Tyrosine Hydroxylase/TH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

S. Moore

Verified customer

Asked: 2019-03-26

Answer

It shows on the product datasheet, PB9449 anti-Tyrosine Hydroxylase/TH antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-03-26

Question

Does anti-Tyrosine Hydroxylase/TH antibody PB9449 work for WB with substantia nigra?

Verified Customer

Verified customer

Asked: 2019-02-14

Answer

According to the expression profile of substantia nigra, TH is highly expressed in substantia nigra. So, it is likely that anti-Tyrosine Hydroxylase/TH antibody PB9449 will work for WB with substantia nigra.

Boster Scientific Support

Answered: 2019-02-14

Question

I have a question about product PB9449, anti-Tyrosine Hydroxylase/TH antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

H. Baker

Verified customer

Asked: 2018-09-26

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9449 anti-Tyrosine Hydroxylase/TH antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-09-26

Question

I see that the anti-Tyrosine Hydroxylase/TH antibody PB9449 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-09-07

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-09-07

Question

See below the WB image, lot number and protocol we used for substantia nigra using anti-Tyrosine Hydroxylase/TH antibody PB9449. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-06-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-28

Question

Is this PB9449 anti-Tyrosine Hydroxylase/TH antibody reactive to the isotypes of TH?

Verified Customer

Verified customer

Asked: 2018-05-16

Answer

The immunogen of PB9449 anti-Tyrosine Hydroxylase/TH antibody is A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-05-16

Question

you antibody to test anti-Tyrosine Hydroxylase/TH antibody PB9449 on rat substantia nigra for research purposes, then I may be interested in using anti-Tyrosine Hydroxylase/TH antibody PB9449 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

T. Baker

Verified customer

Asked: 2015-10-27

Answer

The products we sell, including anti-Tyrosine Hydroxylase/TH antibody PB9449, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-10-27

Conjugation

how to order through PO

Size

Total: $280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9449
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.