ASCL2 (NM_005170) Human Recombinant Protein

ASCL2/Mash2 protein,

Recombinant protein of human achaete-scute complex homolog 2 (Drosophila) (ASCL2)

Product Info Summary

SKU: PROTQ99929
Size: 20 µg
Source: HEK293T

Product Name

ASCL2 (NM_005170) Human Recombinant Protein

View all ASCL2/Mash2 recombinant proteins

SKU/Catalog Number

PROTQ99929

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human achaete-scute complex homolog 2 (Drosophila) (ASCL2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ASCL2 (NM_005170) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99929)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.185kDa

Amino Acid Sequence

MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY

Validation Images & Assay Conditions

Gene/Protein Information For ASCL2 (Source: Uniprot.org, NCBI)

Gene Name

ASCL2

Full Name

Achaete-scute homolog 2

Weight

20.185kDa

Alternative Names

achaete-scute complex (Drosophila) homolog-like 2; achaete-scute complex homolog 2 (Drosophila); achaete-scute complex-like 2 (Drosophila); ASCL2; ASH2; ASH-2; BHLHA45; bHLHa45achaete-scute homolog 2; Class A basic helix-loop-helix protein 45; HASH2; HASH2achaete-scute complex-like 2; mammalian achaete/scute homologue 2; Mash2 ASCL2 ASH2, HASH2, MASH2, bHLHa45 achaete-scute family bHLH transcription factor 2 achaete-scute homolog 2|achaete-scute complex homolog 2|achaete-scute complex-like 2|class A basic helix-loop-helix protein 45|mammalian achaete/scute homologue 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ASCL2, check out the ASCL2 Infographic

ASCL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ASCL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99929

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ASCL2 (NM_005170) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ASCL2 (NM_005170) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ASCL2 (NM_005170) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99929
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.