Anti-ABP1/AOC1 Antibody Picoband®

AOC1 antibody

Boster Bio Anti-ABP1/AOC1 Antibody Picoband® catalog # PB10040. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: PB10040
Size: 100 μg/vial
Reactive Species: Human, Monkey
Host: Rabbit
Application: IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-ABP1/AOC1 Antibody Picoband®

View all AOC1 Antibodies

SKU/Catalog Number

PB10040
PB1074 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ABP1/AOC1 Antibody Picoband® catalog # PB10040. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ABP1/AOC1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10040)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1, different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10040 is reactive to AOC1 in Human, Monkey

Observed Molecular Weight

85 kDa

Calculated molecular weight

85.4 kDa

Background of AOC1

This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10040 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Monkey
Immunohistochemistry(Paraffin-embedded Section)2-5 μg/mlHuman
Flow Cytometry (Fixed)1-3 μg/1x106 cellsHuman

Tested application

ABP1 antibody was positively detected by WB in:
human 293T whole cell, human HK-2 whole cell, monkey COS-7 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
ABP1 antibody was positively detected by IHC in:
human colonic adenoma tissue, human placenta tissue, human renal cell carcinoma tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
ABP1 antibody was positively detected by ICC/IF in:
T-47D cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-ABP1/AOC1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-ABP1/AOC1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-ABP1/AOC1 Antibody Picoband®

Question

Is this PB10040 anti-ABP1/AOC1 antibody reactive to the isotypes of AOC1?

Verified Customer

Verified customer

Asked: 2020-04-28

Answer

The immunogen of PB10040 anti-ABP1/AOC1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-28

Question

We are currently using anti-ABP1/AOC1 antibody PB10040 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-07

Answer

The anti-ABP1/AOC1 antibody (PB10040) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-07

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for kidney using anti-ABP1/AOC1 antibody PB10040. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-04-11

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-04-11

Order DetailsPrice
PB10040

100μg

$370
PB10040-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB10040-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB10040-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB10040-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB10040-APC

100 μg APC conjugated (liquid)

$820
PB10040-FITC

100 μg FITC conjugated (liquid)

$570
PB10040-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB10040-Biotin

100 μg Biotin conjugated (liquid)

$570
PB10040-HRP

100 μg HRP conjugated (liquid)

$570
PB10040-PE

100 μg PE conjugated (liquid)

$820
PB10040-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10040
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 8, 2026