Product Info Summary
| SKU: | PB9478 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®
SKU/Catalog Number
PB9478
PB0502 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband® catalog # PB9478. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9478)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH, identical to the related mouse sequence.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9478 is reactive to ASPH in Human, Mouse, Rat
Observed Molecular Weight
100 kDa
Calculated molecular weight
85.9 kDa
Background of ASPH
ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9478 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat |
| Immunohistochemistry (Paraffin-embedded Section) | 0.5-1μg/ml | Human |
| Immunocytochemistry | 0.5-1μg/ml | Human |
| Flow Cytometry (Fixed) | 1-3μg/1x106 cells | Human |
Note: For flow cytometry (FCM), validated for fixed cells only. Not validated for FACS or surface flow cytometry using live cells.
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of ASPH using anti-ASPH antibody (PB9478).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: Rat Brain Tissue Lysate,
Lane 2: Rat Liver Tissue Lysate,
Lane 3: HELA Whole Cell Lysate,
Lane 4: HEPG2 Whole Cell Lysate,
Lane 5: HEPA Whole Cell Lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ASPH antigen affinity purified polyclonal antibody (Catalog # PB9478) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ASPH at approximately 100KD. The expected band size for ASPH is at 86KD.
Click image to see more details
Immunoblotting detection of the ASPH protein. TC-1, TC-1/dASPH, TC-1/A9 and MK16/KLL cells were treated with 20 μM MO-I-1151 inhibitor for 24 h and DMSO was used as a control. Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was used as an internal control. Antibodies applied for ASPH staining are indicated.
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
The effect of ASPH inhibition on cell proliferation. (A) TC-1, TC-1/dASPH, TC-1/A9 and MK16/KLL cells were treated with the MO-I-1151 inhibitor at concentration 0.1, 1, 5, 10 and 20 μM for 48 h and then subjected to an MTT assay or (B) incubated with MO-I-1151 at 20 μM for 7 days, stained with crystal violet and photographed. Images were quantified by ImageJ software. DMSO was used as a control. Data represents the mean ± SEM of three independent experiments. Statistical significance refers to the comparison with the non-treated (DMSO) samples. * p <0.05, ** p <0.01, *** p <0.001, **** p <0.0001 by t -test.
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
The effect of ASPH inhibition on cell migration. (A) Confluent TC-1, TC-1/dASPH, TC-1/A9 and MK16/KLL cells were incubated with 20 μM MO-I-1151 for the indicated times. The migration was measured by the area of the wound made in cells and images were taken at 0, 6 and 12 h and images were quantified using ImageJ software. (B) Cell lines were treated with 20 μM MO-I-1151 in transwell chambers. After 24 h, the cells were fixed and stained. Microscopic images were quantified by ImageJ software. DMSO was used as a control. Data represents the mean ± SEM of three independent experiments. Statistical significance refers to the comparison with the non-treated (DMSO) samples. * p <0.05 , ** p <0.01 by t -test.
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
The effect of ASPH inhibition on cell invasions. (A) Spheroids were embedded into a 3D collagen matrix and treated with 20 μM MO-I-1151. Images were taken at 0 and 72 h and quantified by ImageJ software. (B) Cell lines were treated with 20 μM MO-I-1151 in pre-coated Matrigel transwell chambers. After 24 h, the cells were fixed and stained. Microscopic images were quantified by ImageJ software. DMSO was used as a control. Data represents the mean ± SEM of three independent experiments. Statistical significance refers to the comparison with the non-treated (DMSO) samples. * p <0.05, ** p <0.01 by t -test.
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
The effect of ASPH inhibition on cellular signaling. Cells were treated with 20 μM MO-I-1151 for 24 h (DMSO was used as a control), and protein samples were collected and subjected to SDS-PAGE electrophoresis and immunoblotting. Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was used as an internal control. (A) Notch and SRC pathways, (B) epithelial-mesenchymal pathway.
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
The effect of ASPH downregulation on gene expression. Bulk RNA-seq was performed after ASPH inhibition with 20 μM MO-I-1151 inhibitor for 24 h in TC-1, TC-1/A9, and MK16/KLL cells or ASPH deactivation with CRISPR/Cas9 in TC-1/dASPH cells (n=3). DMSO was used as a control . (A) Differential gene expression. Orange dots indicate genes with at least 2-fold decreased or increased expression and p adj ≤0.01. Numbers of these genes are indicated in green and red colors, respectively. (B) Overlap of down- and upregulated genes. (C) Enrichment analysis. Some of the most significant differences found with Hallmark and Reactome gene sets are shown.
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
The effect of ASPH inhibition on regulation of Ly6 family members. Cells were treated with 20 μM MO-I-1151 inhibitor for 24 h and DMSO was used as a control. (A) Ly6a and Ly6c1 expression was detected by RT-qPCR and relative quantification was calculated. Data represents the mean ± SEM of three independent experiments. TC-1, TC-1/A9, and MK16/KLL cell lines incubated with MO-I-1151 were compared with DMSO-treated controls and TC-1/dASPH cells with TC-1 cell line. * p <0.05, ** p <0.01 by t -test. (B, C, D) Ly6 proteins were examined by immunoblotting. Equal amounts of proteins were subjected to SDS-PAGE. GAPDH was used as an internal control. Ly6a and Ly6c were detected in cell lines TC-1/dASPH, TC-1, TC-1/A9, and MK16/KLL (B) and RMA, JUN-3, 4T1, and B16-F10 (C) and Ly6D and Ly6K in human cell lines HeLa, CaSki, MCF-7, Detroit 562 and SiHa (D) .
Index in PubMed under a CC BY license. PMID: 38356711
Click image to see more details
IHC analysis of ASPH using anti-ASPH antibody (PB9478). ASPH was detected in paraffin-embedded section of Human Mammary Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ASPH Antibody (PB9478) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
IHC analysis of ASPH using anti-ASPH antibody (PB9478).
ASPH was detected in immunocytochemical section of A549 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 1μg/ml rabbit anti-ASPH Antibody ( PB9478) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Flow Cytometry analysis of HeLa cells using anti-ASPH antibody (PB9478).
Overlay histogram showing HeLa cells stained with PB9478 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ASPH Antibody (PB9478,1μg/1x106 cells) for 30 min at 20°C. DyLight488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Click image to see more details
Flow Cytometry analysis of U87 cells using anti-ASPH antibody (PB9478).
Overlay histogram showing U87 cells stained with PB9478 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ASPH Antibody (PB9478,1μg/1x106 cells) for 30 min at 20°C. DyLight488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Specific Publications For Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband® (PB9478)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®
Question
I was wanting to use your anti-Aspartate beta hydroxylase/ASPH antibody for ICC for mouse liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse liver identification?
Verified Customer
Verified customer
Asked: 2020-02-10
Answer
It shows on the product datasheet, PB9478 anti-Aspartate beta hydroxylase/ASPH antibody has been tested for Flow Cytometry, IHC-P, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse liver in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-10
Question
We are currently using anti-Aspartate beta hydroxylase/ASPH antibody PB9478 for human tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-13
Answer
The anti-Aspartate beta hydroxylase/ASPH antibody (PB9478) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-13
Question
I am looking for to test anti-Aspartate beta hydroxylase/ASPH antibody PB9478 on mouse liver for research purposes, then I may be interested in using anti-Aspartate beta hydroxylase/ASPH antibody PB9478 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-08-28
Answer
The products we sell, including anti-Aspartate beta hydroxylase/ASPH antibody PB9478, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-08-28
Question
Will anti-Aspartate beta hydroxylase/ASPH antibody PB9478 work for ICC with liver?
O. Carter
Verified customer
Asked: 2017-06-19
Answer
According to the expression profile of liver, ASPH is highly expressed in liver. So, it is likely that anti-Aspartate beta hydroxylase/ASPH antibody PB9478 will work for ICC with liver.
Boster Scientific Support
Answered: 2017-06-19
Question
Does PB9478 anti-Aspartate beta hydroxylase/ASPH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
R. Kulkarni
Verified customer
Asked: 2016-02-11
Answer
As indicated on the product datasheet, PB9478 anti-Aspartate beta hydroxylase/ASPH antibody as been tested on ICC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2016-02-11
Question
See below the WB image, lot number and protocol we used for liver using anti-Aspartate beta hydroxylase/ASPH antibody PB9478. Please let me know if you require anything else.
F. Johnson
Verified customer
Asked: 2013-12-26
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-12-26
Question
Is this PB9478 anti-Aspartate beta hydroxylase/ASPH antibody reactive to the isotypes of ASPH?
A. Jha
Verified customer
Asked: 2013-03-19
Answer
The immunogen of PB9478 anti-Aspartate beta hydroxylase/ASPH antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2013-03-19

