Anti-DARPP32/PPP1R1B Antibody Picoband®

PPP1R1B antibody

Boster Bio Anti-DARPP32/PPP1R1B Antibody Picoband® catalog # PB9879. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9879
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-DARPP32/PPP1R1B Antibody Picoband®

View all PPP1R1B Antibodies

SKU/Catalog Number

PB9879
PB0902 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-DARPP32/PPP1R1B Antibody Picoband® catalog # PB9879. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-DARPP32/PPP1R1B Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9879)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9879 is reactive to PPP1R1B in Human, Mouse, Rat

Observed Molecular Weight

32 kDa

Calculated molecular weight

23.0 kDa

Background of PPP1R1B

Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9879 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

DARPP32 antibody was positively detected by WB in:
human CACO-2 whole cell, rat brain tissue, mouse brain tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
DARPP32 antibody was positively detected by IHC in:
mouse pancreas tissue, rat intestine tissue, human lung cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
DARPP32 antibody was positively detected by FC in:
THP-1 cell, PC-3 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-DARPP32/PPP1R1B Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-DARPP32/PPP1R1B Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-DARPP32/PPP1R1B Antibody Picoband®

Question

I was wanting to use your anti-DARPP32/PPP1R1B antibody for WB for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

As indicated on the product datasheet, PB9879 anti-DARPP32/PPP1R1B antibody has been validated for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-17

Question

Do you have a BSA free version of anti-DARPP32/PPP1R1B antibody PB9879 available?

Verified Customer

Verified customer

Asked: 2019-11-19

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-DARPP32/PPP1R1B antibody PB9879 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-19

Question

Does anti-DARPP32/PPP1R1B antibody PB9879 work on zebrafish Flow Cytometry with adipose tissue?

Verified Customer

Verified customer

Asked: 2019-08-09

Answer

Our lab technicians have not validated anti-DARPP32/PPP1R1B antibody PB9879 on zebrafish. You can run a BLAST between zebrafish and the immunogen sequence of anti-DARPP32/PPP1R1B antibody PB9879 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated zebrafish samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in zebrafish adipose tissue in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-09

Question

Is this PB9879 anti-DARPP32/PPP1R1B antibody reactive to the isotypes of PPP1R1B?

B. Lewis

Verified customer

Asked: 2019-07-26

Answer

The immunogen of PB9879 anti-DARPP32/PPP1R1B antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-26

Question

We are currently using anti-DARPP32/PPP1R1B antibody PB9879 for mouse tissue, and we are satisfied with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2018-01-30

Answer

The anti-DARPP32/PPP1R1B antibody (PB9879) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-30

Question

Will PB9879 anti-DARPP32/PPP1R1B antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

E. Singh

Verified customer

Asked: 2017-11-27

Answer

It shows on the product datasheet, PB9879 anti-DARPP32/PPP1R1B antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-11-27

Order DetailsPrice
PB9879

100μg

$370
PB9879-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9879-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9879-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9879-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9879-APC

100 μg APC conjugated (liquid)

$820
PB9879-FITC

100 μg FITC conjugated (liquid)

$570
PB9879-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9879-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9879-HRP

100 μg HRP conjugated (liquid)

$570
PB9879-PE

100 μg PE conjugated (liquid)

$820
PB9879-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9879
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 6, 2026