Product Info Summary
| SKU: | PB9315 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PIM1 Antibody Picoband®
SKU/Catalog Number
PB9315
PB0352 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PIM1 Antibody Picoband® catalog # PB9315. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PIM1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9315)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1, different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9315 is reactive to PIM1 in Human
Observed Molecular Weight
44 kDa
Calculated molecular weight
35.7 kDa
Background of PIM1
Proto-oncogene serine/threonine-protein kinase Pim-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, Pim-1 has also been found to be highly expressed in cell cultures isolated from human tumors. Pim-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. PIM1 also has a role in cardioprotection downstream of AKT activation.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9315 is guaranteed for WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Human |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of PIM1 using anti-PIM1 antibody (PB9315).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.
Lane 1: human K562 whole cell lysates,
Lane 2: human U20S whole cell lysates,
Lane 3: human Hela whole cell lysates,
Lane 4: human MCF-7 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PIM1 antigen affinity purified polyclonal antibody (Catalog # PB9315) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PIM1 at approximately 44KD. The expected band size for PIM1 is at 44KD.
Specific Publications For Anti-PIM1 Antibody Picoband® (PB9315)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PIM1 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-PIM1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-PIM1 Antibody Picoband®
Question
Here is the WB image, lot number and protocol we used for lower esophagus mucosa using anti-PIM1 antibody PB9315. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-01-22
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-22
Question
We are currently using anti-PIM1 antibody PB9315 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-17
Answer
The anti-PIM1 antibody (PB9315) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-17
Question
you antibody to test anti-PIM1 antibody PB9315 on human lower esophagus mucosa for research purposes, then I may be interested in using anti-PIM1 antibody PB9315 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-11-05
Answer
The products we sell, including anti-PIM1 antibody PB9315, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-05
Question
Is a blocking peptide available for product anti-PIM1 antibody (PB9315)?
Verified Customer
Verified customer
Asked: 2019-08-27
Answer
We do provide the blocking peptide for product anti-PIM1 antibody (PB9315). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2019-08-27
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lower esophagus mucosa using anti-PIM1 antibody PB9315. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-08-26
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-26
Question
We have observed staining in human lower esophagus mucosa. Any tips? Is anti-PIM1 antibody supposed to stain lower esophagus mucosa positively?
Verified Customer
Verified customer
Asked: 2019-08-26
Answer
According to literature lower esophagus mucosa does express PIM1. According to Uniprot.org, PIM1 is expressed in lower esophagus mucosa, kidney, erythroleukemia, among other tissues. Regarding which tissues have PIM1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-08-26
Question
I see that the anti-PIM1 antibody PB9315 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-08-15
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-08-15
Question
Is there a BSA free version of anti-PIM1 antibody PB9315 available?
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-PIM1 antibody PB9315 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-05-27
Question
I am looking for using your anti-PIM1 antibody for positive regulation of cardioblast proliferation studies. Has this antibody been tested with western blotting on a549 whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-16
Answer
We appreciate your inquiry. This PB9315 anti-PIM1 antibody is tested on human a549, u2os whole cell lysates, a549 whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-16
Question
Is this PB9315 anti-PIM1 antibody reactive to the isotypes of PIM1?
A. Jha
Verified customer
Asked: 2018-02-02
Answer
The immunogen of PB9315 anti-PIM1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-02-02
Question
Our team were well pleased with the WB result of your anti-PIM1 antibody. However we have been able to see positive staining in kidney isoform 1: cytoplasm. nucleus. using this antibody. Is that expected? Could you tell me where is PIM1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-12-20
Answer
Based on literature, kidney does express PIM1. Generally PIM1 expresses in isoform 1: cytoplasm. nucleus., isoform 2: cell membrane. Regarding which tissues have PIM1 expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2017-12-20
Question
I was wanting to use your anti-PIM1 antibody for WB for human lower esophagus mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lower esophagus mucosa identification?
Verified Customer
Verified customer
Asked: 2017-11-03
Answer
It shows on the product datasheet, PB9315 anti-PIM1 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lower esophagus mucosa in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-11-03
Question
Can you help my question with product PB9315, anti-PIM1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
M. Zhang
Verified customer
Asked: 2015-07-24
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9315 anti-PIM1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2015-07-24
Question
Does anti-PIM1 antibody PB9315 work for WB with lower esophagus mucosa?
G. Huang
Verified customer
Asked: 2015-03-10
Answer
According to the expression profile of lower esophagus mucosa, PIM1 is highly expressed in lower esophagus mucosa. So, it is likely that anti-PIM1 antibody PB9315 will work for WB with lower esophagus mucosa.
Boster Scientific Support
Answered: 2015-03-10
Question
Would PB9315 anti-PIM1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
V. Bhatt
Verified customer
Asked: 2013-09-18
Answer
As indicated on the product datasheet, PB9315 anti-PIM1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-09-18

