Anti-PML Protein Antibody Picoband®

PML antibody

Boster Bio Anti-PML Protein Antibody Picoband® catalog # PB10084. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB10084
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-PML Protein Antibody Picoband®

View all PML Antibodies

SKU/Catalog Number

PB10084

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PML Protein Antibody Picoband® catalog # PB10084. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PML Protein Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10084)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein, different from the related mouse sequence by eight amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10084 is reactive to PML in Human

Observed Molecular Weight

90-160 kDa

Calculated molecular weight

97.6 kDa

Background of PML

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10084 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

PML antibody was positively detected by WB in:
human Hela whole cell, human HEK293 whole cell, human U87 whole cell, human A431 whole cell, human K562 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
PML antibody was positively detected by IHC in:
human intestinal cancer tissue, human mammary cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
PML antibody was positively detected by FC in:
A431 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-PML Protein Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-PML Protein Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-PML Protein Antibody Picoband®

Question

I was wanting to use your anti-PML Protein antibody for WB for human left lobe of thyroid gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human left lobe of thyroid gland identification?

Verified Customer

Verified customer

Asked: 2020-04-09

Answer

As indicated on the product datasheet, PB10084 anti-PML Protein antibody has been validated for Flow Cytometry, IHC-P, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human left lobe of thyroid gland in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-09

Question

My boss were satisfied with the WB result of your anti-PML Protein antibody. However we have seen positive staining in liver nucleus. nucleus using this antibody. Is that expected? Could you tell me where is PML supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-01-24

Answer

From what I have seen in literature, liver does express PML. Generally PML expresses in nucleus. nucleus, nucleoplasm. cytoplasm. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2020-01-24

Question

We bought anti-PML Protein antibody for Flow Cytometry on brain in the past. I am using human, and We want to use the antibody for WB next. My lab would like examining brain as well as liver in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2020-01-20

Answer

I viewed the website and datasheets of our anti-PML Protein antibody and I see that PB10084 has been validated on human in both Flow Cytometry and WB. Thus PB10084 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-01-20

Question

Can PB10084 be used for IHC-Fr and ICC/IF staining?

Verified customer

Asked: 2019-04-22

Answer

The Anti-PML Protein Antibody Picoband™ (PB10084) has been tested for IHC-F and ICC. The recommended dilutions are: Immunohistochemistry(Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human

Boster Scientific Support

Answered: 2019-04-22

Question

My question regarding product PB10084, anti-PML Protein antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-04-01

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10084 anti-PML Protein antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-04-01

Question

Is this PB10084 anti-PML Protein antibody reactive to the isotypes of PML?

Verified Customer

Verified customer

Asked: 2018-11-14

Answer

The immunogen of PB10084 anti-PML Protein antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein (141-179aa FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD), different from the related mouse sequence by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-11-14

Question

Do you have a BSA free version of anti-PML Protein antibody PB10084 available?

Verified Customer

Verified customer

Asked: 2018-06-26

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PML Protein antibody PB10084 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-06-26

Question

Is a blocking peptide available for product anti-PML Protein antibody (PB10084)?

J. Miller

Verified customer

Asked: 2017-09-06

Answer

We do provide the blocking peptide for product anti-PML Protein antibody (PB10084). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2017-09-06

Question

Does PB10084 anti-PML Protein antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

B. Zhao

Verified customer

Asked: 2017-08-18

Answer

It shows on the product datasheet, PB10084 anti-PML Protein antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-08-18

Question

See attached the WB image, lot number and protocol we used for left lobe of thyroid gland using anti-PML Protein antibody PB10084. Please let me know if you require anything else.

M. Johnson

Verified customer

Asked: 2017-07-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-07-28

Question

Will anti-PML Protein antibody PB10084 work for WB with left lobe of thyroid gland?

W. Carter

Verified customer

Asked: 2015-12-29

Answer

According to the expression profile of left lobe of thyroid gland, PML is highly expressed in left lobe of thyroid gland. So, it is likely that anti-PML Protein antibody PB10084 will work for WB with left lobe of thyroid gland.

Boster Scientific Support

Answered: 2015-12-29

Question

We are currently using anti-PML Protein antibody PB10084 for human tissue, and we are well pleased with the IHC-P results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?

M. Lewis

Verified customer

Asked: 2015-06-26

Answer

The anti-PML Protein antibody (PB10084) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-06-26

Question

We have been able to see staining in human cervix carcinoma erythroleukemia. Do you have any suggestions? Is anti-PML Protein antibody supposed to stain cervix carcinoma erythroleukemia positively?

M. Zhang

Verified customer

Asked: 2015-05-08

Answer

From what I have seen in literature cervix carcinoma erythroleukemia does express PML. From what I have seen in Uniprot.org, PML is expressed in left lobe of thyroid gland, brain, kidney, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have PML expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16572171
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Kidney, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2015-05-08

Question

I see that the anti-PML Protein antibody PB10084 works with WB, what is the protocol used to produce the result images on the product page?

A. Roberts

Verified customer

Asked: 2015-04-24

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2015-04-24

Question

I am interested in to test anti-PML Protein antibody PB10084 on human left lobe of thyroid gland for research purposes, then I may be interested in using anti-PML Protein antibody PB10084 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

A. Anderson

Verified customer

Asked: 2014-12-24

Answer

The products we sell, including anti-PML Protein antibody PB10084, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2014-12-24

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for left lobe of thyroid gland using anti-PML Protein antibody PB10084. Let me know if you need anything else.

S. Anderson

Verified customer

Asked: 2013-10-28

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-10-28

Question

I am looking for using your anti-PML Protein antibody for telomeric region studies. Has this antibody been tested with western blotting on sw620 whole cell lysates? We would like to see some validation images before ordering.

G. Singh

Verified customer

Asked: 2013-06-20

Answer

We appreciate your inquiry. This PB10084 anti-PML Protein antibody is validated on sw620 whole cell lysates, u20s whole cell lysates, a431 cells. It is guaranteed to work for Flow Cytometry, IHC-P, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2013-06-20

Order DetailsPrice
PB10084

100μg

$370
PB10084-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB10084-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB10084-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB10084-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB10084-APC

100 μg APC conjugated (liquid)

$820
PB10084-FITC

100 μg FITC conjugated (liquid)

$570
PB10084-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB10084-Biotin

100 μg Biotin conjugated (liquid)

$570
PB10084-HRP

100 μg HRP conjugated (liquid)

$570
PB10084-PE

100 μg PE conjugated (liquid)

$820
PB10084-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10084
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 1, 2026